MediaWiki API help
This is an auto-generated MediaWiki Action API documentation page.
General information
Status: The MediaWiki API is a mature and stable interface that is actively supported and improved. While we try to avoid it, we may occasionally need to make breaking changes; subscribe to the mediawiki-api-announce mailing list for notice of updates.
Erroneous requests: When erroneous requests are sent to the API, an HTTP header will be sent with the key "MediaWiki-API-Error" and then both the value of the header and the error code sent back will be set to the same value. For more information see API: Errors and warnings.
Testing: For ease of testing API requests, see Special:ApiSandbox.
Request methods
Action API requests may use GET and POST methods. Prefer using the GET method, which allows requests to be routed to faster replica servers and responses to be cached, unless the length of the URL with parameters would exceed its length limit (commonly 8000 bytes), or a module only accepts POST requests.
Parameters for POST requests may be sent in the query part of the request URL (like in GET requests) and in the POST request body, and mixing both ways in one request is allowed. Certain parameters such as passwords must be sent in the request body. If the same parameter is sent as part of the URL and also in the request body, it must have the same value in both places.
Data types
Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.
Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.
Some parameter types in API requests need further explanation:
- boolean
Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.
- expiry
Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.
- timestamp
Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. The string now may be used to specify the current time.
Limits
Most API modules can accept up to 50 inputs in multivalue parameters, and can return up to 500 results per query (50 results for slow queries).
For users with the apihighlimits right (Bots and Administrators), the limits are increased to 500 inputs and 5,000 results (500 results for slow queries).
Templated parameters
Templated parameters support cases where an API module needs a value for each value of some other parameter. For example, if there were an API module to request fruit, it might have a parameter fruits to specify which fruits are being requested and a templated parameter {fruit}-quantity to specify how many of each fruit to request. An API client that wants 1 apple, 5 bananas, and 20 strawberries could then make a request like fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.
Main module
- Source: MediaWiki
- License: GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Which action to perform. This parameter should be sent as part of the request URL (not the POST body) for ease of use in debugging, analytics, and request routing or filtering.
- abusefiltercheckmatch
- Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
- abusefilterchecksyntax
- Check syntax of an AbuseFilter filter.
- abusefilterevalexpression
- Evaluates an AbuseFilter expression.
- abusefilterunblockautopromote
- Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- abuselogprivatedetails
- View private details of an AbuseLog entry.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- antispoof
- Check a username against AntiSpoof's normalisation checks.
- block
- Block a user.
- changeauthenticationdata
- Change authentication data for the current user.
- changecontentmodel
- Change the content model of a page
- checktoken
- Check the validity of a token from action=query&meta=tokens.
- clearhasmsg
- Clears the
hasmsgflag for the current user. - clientlogin
- Log in to the wiki using the interactive flow.
- compare
- Get the difference between two pages.
- createaccount
- Create a new user account.
- delete
- Delete a page.
- discussiontoolsedit
- Post a message on a discussion page.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Get the subscription statuses of given topics.
- discussiontoolssubscribe
- Subscribe (or unsubscribe) to receive notifications about a topic.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Mark notifications as read for the current user.
- echomarkseen
- Mark notifications as seen for the current user.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Create and edit pages.
- emailuser
- Email a user.
- expandtemplates
- Expands all templates within wikitext.
- feedcontributions
- Returns a user's contributions feed.
- feedrecentchanges
- Returns a recent changes feed.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Revert a file to an old version.
- help
- Display help for the specified modules.
- imagerotate
- Rotate one or more images.
- import
- Import a page from another wiki, or from an XML file.
- languagesearch
- Search for language names in any script.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Log out and clear session data.
- managetags
- Perform management tasks relating to change tags.
- mergehistory
- Merge page histories.
- move
- Move a page.
- opensearch
- Search the wiki using the OpenSearch protocol.
- options
- Change preferences of the current user.
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Change the protection level of a page.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- spamblacklist
- Validate one or more URLs against the spam block list.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Fetch data stored by the TemplateData extension.
- thank
- Send a thank-you notification to an editor.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- wbavailablebadges
- Queries available badge items.
- wbcreateclaim
- Creates Wikibase claims.
- wbcreateredirect
- Creates Entity redirects.
- wbeditentity
- Creates a single new Wikibase entity and modifies it with serialised information.
- wbformatentities
- Formats entity IDs to HTML or plain text.
- wbformatvalue
- Formats DataValues.
- wbgetclaims
- Gets Wikibase claims.
- wbgetentities
- Gets the data for multiple Wikibase entities.
- wblinktitles
- Associates two pages on two different wikis with a Wikibase item.
- wbmergeitems
- Merges multiple items.
- wbparsevalue
- Parses values using a
ValueParser. - wbremoveclaims
- Removes Wikibase claims.
- wbremovequalifiers
- Removes a qualifier from a claim.
- wbremovereferences
- Removes one or more references of the same statement.
- wbsearchentities
- Searches for entities using labels and aliases.
- wbsetaliases
- Sets the aliases for a Wikibase entity.
- wbsetclaim
- Creates or updates an entire Statement or Claim.
- wbsetclaimvalue
- Sets the value of a Wikibase claim.
- wbsetdescription
- Sets a description for a single Wikibase entity.
- wbsetlabel
- Sets a label for a single Wikibase entity.
- wbsetqualifier
- Creates a qualifier or sets the value of an existing one.
- wbsetreference
- Creates a reference or sets the value of an existing one.
- wbsetsitelink
- Associates a page on a wiki with a Wikibase item or removes an already made such association.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- categorytree
- Internal. Internal module for the CategoryTree extension.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- discussiontoolscompare
- Internal. Get information about comment changes between two page revisions.
- discussiontoolspageinfo
- Internal. Returns metadata required to initialize the discussion tools.
- discussiontoolspreview
- Internal. Preview a message on a discussion page.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- stashedit
- Internal. Prepare an edit in shared cache.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, compare, createaccount, delete, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, emailuser, expandtemplates, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, help, imagerotate, import, languagesearch, linkaccount, login, logout, managetags, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setnotificationtimestamp, setpagelanguage, spamblacklist, tag, templatedata, thank, titleblacklist, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, wbavailablebadges, wbcreateclaim, wbcreateredirect, wbeditentity, wbformatentities, wbformatvalue, wbgetclaims, wbgetentities, wblinktitles, wbmergeitems, wbparsevalue, wbremoveclaims, wbremovequalifiers, wbremovereferences, wbsearchentities, wbsetaliases, wbsetclaim, wbsetclaimvalue, wbsetdescription, wbsetlabel, wbsetqualifier, wbsetreference, wbsetsitelink, webauthn, categorytree, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, cspreport, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, editcheckreferenceurl, scribunto-console, stashedit, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Default: help
- format
The format of the output.
- json
- Output data in JSON format.
- jsonfm
- Output data in JSON format (pretty-print in HTML).
- none
- Output nothing.
- php
- Output data in serialized PHP format.
- phpfm
- Output data in serialized PHP format (pretty-print in HTML).
- rawfm
- Output data, including debugging elements, in JSON format (pretty-print in HTML).
- xml
- Output data in XML format.
- xmlfm
- Output data in XML format (pretty-print in HTML).
- One of the following values: json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.- Type: integer
- smaxage
Set the
s-maxageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Set the
max-ageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.
- One of the following values: anon, bot, user
- assertuser
Verify the current user is the named user.
- Type: user, by any of username and Temporary user
- requestid
Any value given here will be included in the response. May be used to distinguish requests.
- servedby
Include the hostname that served the request in the results.
- Type: boolean (details)
- curtimestamp
Include the current timestamp in the result.
- Type: boolean (details)
- responselanginfo
Include the languages used for uselang and errorlang in the result.
- Type: boolean (details)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Type: boolean (details)
- uselang
Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.
- Default: user
- variant
Variant of the language. Only works if the base language supports variant conversion.
- errorformat
Format to use for warning and error text output
- plaintext
- Wikitext with HTML tags removed and entities replaced.
- wikitext
- Unparsed wikitext.
- html
- HTML
- raw
- Message key and parameters.
- none
- No text output, only the error codes.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- One of the following values: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- Default: uselang
- errorsuselocal
If given, error texts will use locally-customized messages from the MediaWiki namespace.
- Type: boolean (details)
- Help for the main module.
- api.php?action=help [open in sandbox]
- All help in one page.
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
action=abusefiltercheckmatch
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
vars, rcid or logid is required however only one may be used.
- filter
The full filter text to check for a match.
- This parameter is required.
- vars
JSON encoded array of variables to test against.
- rcid
Recent change ID to check against.
- Type: integer
- logid
Abuse filter log ID to check against.
- Type: integer
- Test if recent change ID 15 matches a simple filter
- api.php?action=abusefiltercheckmatch&filter=!("autoconfirmed"%20in%20user_groups)&rcid=15 [open in sandbox]
action=abusefilterchecksyntax
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Check syntax of an AbuseFilter filter.
- filter
The full filter text to check syntax on.
- This parameter is required.
- Check syntax of a valid filter
- api.php?action=abusefilterchecksyntax&filter="foo" [open in sandbox]
- Check syntax of an invalid filter
- api.php?action=abusefilterchecksyntax&filter="bar"%20bad_variable [open in sandbox]
action=abusefilterevalexpression
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Evaluates an AbuseFilter expression.
- expression
The expression to evaluate.
- This parameter is required.
- prettyprint
Whether the result should be pretty-printed.
- Type: boolean (details)
- Evaluate a simple expression
- api.php?action=abusefilterevalexpression&expression=lcase("FOO") [open in sandbox]
- Evaluate a simple expression, formatting the result
- api.php?action=abusefilterevalexpression&expression=lcase("FOO")&prettyprint=1 [open in sandbox]
action=abusefilterunblockautopromote
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- user
Username of the user you want to unblock.
- This parameter is required.
- Type: user, by username
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Remove the block on User:Example's autopromotion
- api.php?action=abusefilterunblockautopromote&user=Example&token=123ABC [open in sandbox]
action=abuselogprivatedetails
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Abuse Filter
- License: GPL-2.0-or-later
View private details of an AbuseLog entry.
- logid
The ID of the AbuseLog entry to be checked.
- Type: integer
- reason
A valid reason for performing the check.
- Default: (empty)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Get private details for the AbuseLog entry with ID 1, using the reason "example".
- api.php?action=abuselogprivatedetails&logid=1&reason=example&token=ABC123 [open in sandbox]
action=acquiretempusername
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
If the user later performs an action that results in temp account creation, the stashed username will be used for their account. It may also be used in previews. However, the account is not created yet, and the name is not visible to other users.
action=antispoof
- This module requires read rights.
- Source: AntiSpoof
- License: GPL-2.0-or-later
Check a username against AntiSpoof's normalisation checks.
- username
The username to check against AntiSpoof.
- This parameter is required.
- Check username "Foo" against AntiSpoof
- api.php?action=antispoof&username=Foo [open in sandbox]
action=block
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Block a user.
- id
ID of the block to modify (obtained through list=blocks). Cannot be used together with user, reblock, or newblock.
- Type: integer
- user
User to block. Cannot be used together with id.
- Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
- userid
- Deprecated.
Specify user=#ID instead.
- Type: integer
- expiry
Expiry time. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If set to infinite, indefinite, or never, the block will never expire.
- Default: never
- reason
Reason for block.
- Default: (empty)
- anononly
Block anonymous users only (i.e. disable anonymous edits for this IP address, including temporary account edits).
- Type: boolean (details)
- nocreate
Prevent account creation.
- Type: boolean (details)
- autoblock
Automatically block the last used IP address, and any subsequent IP addresses they try to login from.
- Type: boolean (details)
- noemail
Prevent user from sending email through the wiki. (Requires the
blockemailright).- Type: boolean (details)
- hidename
Hide the username from the block log. (Requires the
hideuserright).- Type: boolean (details)
- allowusertalk
Allow the user to edit their own talk page (depends on $wgBlockAllowsUTEdit).
- Type: boolean (details)
- reblock
If the user is already blocked by a single block, overwrite the existing block. If the user is blocked more than once, this will fail—use the id parameter instead to specify which block to overwrite. Cannot be used together with id or newblock.
- Type: boolean (details)
- newblock
Add another block even if the user is already blocked. Cannot be used together with id or reblock.
- Type: boolean (details)
- watchuser
Watch the user's or IP address's user and talk pages.
- Type: boolean (details)
Change tags to apply to the entry in the block log.
- Values (separate with | or alternative):
- partial
Block user from specific pages or namespaces rather than the entire site.
- Type: boolean (details)
- pagerestrictions
List of titles to block the user from editing. Only applies when partial is set to true.
- Type: page title
- Separate values with | or alternative.
- Maximum number of values is 10.
- Only accepts pages that exist.
- namespacerestrictions
List of namespace IDs to block the user from editing. Only applies when partial is set to true.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- actionrestrictions
List of actions to block the user from performing. Only applies when partial is set to true.
- Values (separate with | or alternative): create, move, thanks, upload
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Block IP address 192.0.2.5 for three days with a reason.
- api.php?action=block&user=192.0.2.5&expiry=3%20days&reason=First%20strike&token=123ABC [open in sandbox]
- Block user Vandal indefinitely with a reason, and prevent new account creation and email sending.
- api.php?action=block&user=Vandal&expiry=never&reason=Vandalism&nocreate=&autoblock=&noemail=&token=123ABC [open in sandbox]
action=categorytree
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CategoryTree
- License: GPL-2.0-or-later
Internal module for the CategoryTree extension.
- category
Title in the category namespace, prefix will be ignored if given.
- This parameter is required.
- options
Options for the CategoryTree constructor as a JSON object. The depth option defaults to 1.
action=changeauthenticationdata (changeauth)
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change authentication data for the current user.
- changeauthrequest
Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=change.
- This parameter is required.
- changeauthtoken
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=change (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Attempt to change the current user's password to ExamplePassword.
- api.php?action=changeauthenticationdata&changeauthrequest=MediaWiki%5CAuth%5CPasswordAuthenticationRequest&password=ExamplePassword&retype=ExamplePassword&changeauthtoken=123ABC [open in sandbox]
action=changecontentmodel
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change the content model of a page
- title
Title of the page to change the contentmodel of. Cannot be used together with pageid.
- pageid
Page ID of the page to change the contentmodel of. Cannot be used together with title.
- Type: integer
- summary
Edit summary and log entry reason
Change tags to apply to the log entry and edit.
- Values (separate with | or alternative):
- model
Content model of the new content.
- This parameter is required.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, vue, wikitext
- bot
Mark the content model change with a bot flag.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Change the main page to have the
textcontent model - api.php?action=changecontentmodel&title=Main Page&model=text&token=123ABC [open in sandbox]
action=checktoken
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Check the validity of a token from action=query&meta=tokens.
- type
Type of token being tested.
- This parameter is required.
- One of the following values: createaccount, csrf, login, patrol, rollback, userrights, watch
- token
Token to test.
- This parameter is required.
- maxtokenage
Maximum allowed age of the token, in seconds.
- Type: integer
- Test the validity of a csrf token.
- api.php?action=checktoken&type=csrf&token=123ABC [open in sandbox]
action=cirrus-check-sanity
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Reports on the correctness of a range of page ids in the search index
- cluster
The search cluster to check indices in
- This parameter is required.
- One of the following values: default
- from
Page id to start checking at
- This parameter is required.
- Type: integer
- The value must be no less than 0.
- limit
The number of page ids to check
- Type: integer or max
- The value must be between 1 and 500.
- Default: 100
- sequenceid
The number of times this set of page ids has been checked
- Type: integer
- rerenderfrequency
Number of checks after which a page should be rerendered. Based off the provided sequenceid.
- Type: integer
- The value must be no less than 2.
- Default: 16
action=cirrus-config-dump
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of CirrusSearch configuration.
- prop
Type of configuration variables to dump
- Values (separate with | or alternative): expectedindices, globals, namespacemap, profiles, replicagroup, usertesting
- Default: globals|namespacemap|profiles|replicagroup
- Get a dump of CirrusSearch configuration.
- api.php?action=cirrus-config-dump [open in sandbox]
action=cirrus-profiles-dump
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of CirrusSearch profiles for this wiki.
- verbose
Dump the profiles content
- Type: boolean (details)
- Get a dump of CirrusSearch profiles for this wiki.
- api.php?action=cirrus-profiles-dump [open in sandbox]
action=cirrus-schema-dump
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of CirrusSearch schema (settings and mappings) for this wiki.
- build
Whether to build the schema from code (true) or fetch from live cluster (false).
- Type: boolean (details)
- plugins
List of OpenSearch/Elasticsearch plugins available on the target cluster. Only used when build=true. If not provided, plugins will be detected from the connected cluster.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get a dump of CirrusSearch schema from the live cluster.
- api.php?action=cirrus-schema-dump [open in sandbox]
- Generate CirrusSearch schema from code configuration.
- api.php?action=cirrus-schema-dump&build=true [open in sandbox]
- Generate CirrusSearch schema with specific plugins enabled.
- api.php?action=cirrus-schema-dump&build=true&plugins=analysis-icu|extra-analysis-textify [open in sandbox]
action=clearhasmsg
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Clears the hasmsg flag for the current user.
- Clear the
hasmsgflag for the current user. - api.php?action=clearhasmsg [open in sandbox]
action=clientlogin (login)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Log in to the wiki using the interactive flow.
The general procedure to use this module is:
- Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=login, and a login token from action=query&meta=tokens.
- Present the fields to the user, and obtain their submission.
- Post to this module, supplying loginreturnurl and any relevant fields.
- Check the status in the response.
- If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
- If you received UI, present the new fields to the user and obtain their submission. Then post to this module with logincontinue and the relevant fields set, and repeat step 4.
- If you received REDIRECT, direct the user to the redirecttarget and wait for the return to loginreturnurl. Then post to this module with logincontinue and any fields passed to the return URL, and repeat step 4.
- If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
- loginrequests
Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=login or from a previous response from this module.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- loginmessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- loginmergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- loginpreservestate
Preserve state from a previous failed login attempt, if possible.
- Type: boolean (details)
- loginreturnurl
Return URL for third-party authentication flows, must be absolute. Either this or logincontinue is required.
Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a logincontinue request to this API module.
- logincontinue
This request is a continuation after an earlier UI or REDIRECT response. Either this or loginreturnurl is required.
- Type: boolean (details)
- logintoken
A "login" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=login (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Start the process of logging in to the wiki as user Example with password ExamplePassword.
- api.php?action=clientlogin&username=Example&password=ExamplePassword&loginreturnurl=http://example.org/&logintoken=123ABC [open in sandbox]
- Continue logging in after a UI response for two-factor auth, supplying an OATHToken of 987654.
- api.php?action=clientlogin&logincontinue=1&OATHToken=987654&logintoken=123ABC [open in sandbox]
action=compare
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get the difference between two pages.
A revision number, a page title, a page ID, text, or a relative reference for both "from" and "to" must be passed.
- fromtitle
First title to compare.
- fromid
First page ID to compare.
- Type: integer
- fromrev
First revision to compare.
- Type: integer
- fromslots
Override content of the revision specified by fromtitle, fromid or fromrev.
This parameter specifies the slots that are to be modified. Use fromtext-{slot}, fromcontentmodel-{slot}, and fromcontentformat-{slot} to specify content for each slot.
- Values (separate with | or alternative): main
- fromtext-{slot}
Text of the specified slot. If omitted, the slot is removed from the revision.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- fromsection-{slot}
When fromtext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by fromtitle, fromid or fromrev as if for a section edit.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- fromcontentformat-{slot}
Content serialization format of fromtext-{slot}.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- fromcontentmodel-{slot}
Content model of fromtext-{slot}. If not supplied, it will be guessed based on the other parameters.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- frompst
Do a pre-save transform on fromtext-{slot}.
- Type: boolean (details)
- fromtext
- Deprecated.
Specify fromslots=main and use fromtext-main instead.
- fromcontentformat
- Deprecated.
Specify fromslots=main and use fromcontentformat-main instead.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- fromcontentmodel
- Deprecated.
Specify fromslots=main and use fromcontentmodel-main instead.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- fromsection
- Deprecated.
Only use the specified section of the specified 'from' content.
- totitle
Second title to compare.
- toid
Second page ID to compare.
- Type: integer
- torev
Second revision to compare.
- Type: integer
- torelative
Use a revision relative to the revision determined from fromtitle, fromid or fromrev. All of the other 'to' options will be ignored.
- One of the following values: cur, next, prev
- toslots
Override content of the revision specified by totitle, toid or torev.
This parameter specifies the slots that are to be modified. Use totext-{slot}, tocontentmodel-{slot}, and tocontentformat-{slot} to specify content for each slot.
- Values (separate with | or alternative): main
- totext-{slot}
Text of the specified slot. If omitted, the slot is removed from the revision.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- tosection-{slot}
When totext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by totitle, toid or torev as if for a section edit.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- tocontentformat-{slot}
Content serialization format of totext-{slot}.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- tocontentmodel-{slot}
Content model of totext-{slot}. If not supplied, it will be guessed based on the other parameters.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- topst
Do a pre-save transform on totext.
- Type: boolean (details)
- totext
- Deprecated.
Specify toslots=main and use totext-main instead.
- tocontentformat
- Deprecated.
Specify toslots=main and use tocontentformat-main instead.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- tocontentmodel
- Deprecated.
Specify toslots=main and use tocontentmodel-main instead.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- tosection
- Deprecated.
Only use the specified section of the specified 'to' content.
- prop
Which pieces of information to get.
- diff
- The diff HTML.
- diffsize
- The size of the diff HTML, in bytes.
- rel
- The revision IDs of the revision previous to 'from' and after 'to', if any.
- ids
- The page and revision IDs of the 'from' and 'to' revisions.
- title
- The page titles of the 'from' and 'to' revisions.
- user
- The username and ID of the 'from' and 'to' revisions. If the user has been revision deleted, a fromuserhidden or touserhidden property will be returned.
- comment
- The comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
- parsedcomment
- The parsed comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
- size
- The size of the 'from' and 'to' revisions.
- timestamp
- The timestamp of the 'from' and 'to' revisions.
- Values (separate with | or alternative): comment, diff, diffsize, ids, parsedcomment, rel, size, timestamp, title, user
- Default: diff|ids|title
- slots
Return individual diffs for these slots, rather than one combined diff for all slots.
- Values (separate with | or alternative): main
- To specify all values, use *.
- difftype
Return the comparison formatted as inline HTML.
- One of the following values: table, unified
- Default: table
- Create a diff between revision 1 and 2.
- api.php?action=compare&fromrev=1&torev=2 [open in sandbox]
action=createaccount (create)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Create a new user account.
The general procedure to use this module is:
- Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=create, and a createaccount token from action=query&meta=tokens.
- Present the fields to the user, and obtain their submission.
- Post to this module, supplying createreturnurl and any relevant fields.
- Check the status in the response.
- If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
- If you received UI, present the new fields to the user and obtain their submission. Then post to this module with createcontinue and the relevant fields set, and repeat step 4.
- If you received REDIRECT, direct the user to the redirecttarget and wait for the return to createreturnurl. Then post to this module with createcontinue and any fields passed to the return URL, and repeat step 4.
- If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
- createrequests
Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=create or from a previous response from this module.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- createmessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- createmergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- createpreservestate
Preserve state from a previous failed login attempt, if possible.
If action=query&meta=authmanagerinfo returned true for hasprimarypreservedstate, requests marked as primary-required should be omitted. If it returned a non-empty value for preservedusername, that username must be used for the username parameter.
- Type: boolean (details)
- createreturnurl
Return URL for third-party authentication flows, must be absolute. Either this or createcontinue is required.
Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a createcontinue request to this API module.
- createcontinue
This request is a continuation after an earlier UI or REDIRECT response. Either this or createreturnurl is required.
- Type: boolean (details)
- createtoken
A "createaccount" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=create (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Start the process of creating the user Example with the password ExamplePassword.
- api.php?action=createaccount&username=Example&password=ExamplePassword&retype=ExamplePassword&createreturnurl=http://example.org/&createtoken=123ABC [open in sandbox]
action=cspreport
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- reportonly
Mark as being a report from a monitoring policy, not an enforced policy
- Type: boolean (details)
- source
What generated the CSP header that triggered this report
- Default: internal
action=delete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Delete a page.
- title
Title of the page to delete. Cannot be used together with pageid.
- pageid
Page ID of the page to delete. Cannot be used together with title.
- Type: integer
- reason
Reason for the deletion. If not set, an automatically generated reason will be used.
Change tags to apply to the entry in the deletion log.
- Values (separate with | or alternative):
- deletetalk
Delete the talk page, if it exists.
- Type: boolean (details)
- watch
- Deprecated.
Add the page to the current user's watchlist.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- unwatch
- Deprecated.
Remove the page from the current user's watchlist.
- Type: boolean (details)
- oldimage
The name of the old image to delete as provided by action=query&prop=imageinfo&iiprop=archivename.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Delete Main Page.
- api.php?action=delete&title=Main%20Page&token=123ABC [open in sandbox]
- Delete Main Page with the reason Preparing for move.
- api.php?action=delete&title=Main%20Page&token=123ABC&reason=Preparing%20for%20move [open in sandbox]
action=discussiontoolscompare
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Get information about comment changes between two page revisions.
- fromtitle
First title to compare.
- fromrev
First revision to compare.
- Type: integer
- totitle
Second title to compare.
- torev
Second revision to compare.
- Type: integer
action=discussiontoolsedit
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Discussion tools
- License: MIT
Post a message on a discussion page.
- paction
Action to perform.
- addcomment
- Add a new comment as a reply to an existing comment.
- addtopic
- Add a new discussion section and the first comment in it.
- This parameter is required.
- One of the following values: addcomment, addtopic
- autosubscribe
Automatically subscribe the user to the talk page thread?
- One of the following values: default, no, yes
- Default: default
- page
The page to perform actions on.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- formtoken
An optional unique ID generated in the client to prevent double-posting.
- Cannot be longer than 16 characters.
- commentname
Name of the comment to reply to. Only used when paction is addcomment.
- commentid
ID of the comment to reply to. Only used when paction is addcomment. Overrides commentname.
- wikitext
Content to post, as wikitext. Cannot be used together with html.
- html
Content to post, as HTML. Cannot be used together with wikitext.
- summary
Edit summary.
- sectiontitle
The title for a new section when using $1section=new. Only used when paction is addtopic.
- allownosectiontitle
Allow posting a new section without a title.
- Type: boolean (details)
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- captchaid
Captcha ID (when saving with a captcha response).
- captchaword
Answer to the captcha (when saving with a captcha response).
- nocontent
Omit the HTML content of the new revision in the response.
Change tags to apply to the edit.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
action=discussiontoolsfindcomment
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Find a comment by its ID or name.
- idorname
Comment ID or name
- heading
Heading hash fragment
- page
Page that the heading hash fragment once existed on
action=discussiontoolsgetsubscriptions
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Get the subscription statuses of given topics.
- commentname
Names of the topics to check
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
action=discussiontoolspageinfo
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Returns metadata required to initialize the discussion tools.
- page
The page to perform actions on.
- oldid
The revision number to use (defaults to latest revision).
- Type: integer
- prop
Which properties to get:
- transcludedfrom
- Which other pages comments have been transcluded from
- threaditemshtml
- Representation of the comment threads parsed from the page
- Values (separate with | or alternative): threaditemshtml, transcludedfrom
- Default: transcludedfrom
- threaditemsflags
Flags to alter the output when using prop=threaditemshtml.
- noreplies
- Don't include the full reply tree, just provide the top-level headings (when using prop=threaditemshtml).
- activity
- Include extra activity data about the oldest and latest replies (when using prop=threaditemshtml).
- excludesignatures
- Exclude user signatures from the comments (when using prop=threaditemshtml).
- Values (separate with | or alternative): activity, excludesignatures, noreplies
- excludesignatures
- Deprecated.
Exclude user signatures from the comments (when using prop=threaditemshtml).
action=discussiontoolspreview
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: Discussion tools
- License: MIT
Preview a message on a discussion page.
- type
Type of message to preview
- reply
- Add a new comment as a reply to an existing comment.
- topic
- Add a new discussion section and the first comment in it.
- This parameter is required.
- One of the following values: reply, topic
- page
The page to perform actions on.
- This parameter is required.
- wikitext
Content to preview, as wikitext.
- This parameter is required.
- sectiontitle
The title for a new section when using section=new.
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
action=discussiontoolssubscribe
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Discussion tools
- License: MIT
Subscribe (or unsubscribe) to receive notifications about a topic.
- page
A page on which the topic appears
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- commentname
Name of the topic to subscribe to (or unsubscribe from)
- This parameter is required.
- subscribe
True to subscribe, false to unsubscribe
- This parameter is required.
- Type: boolean (details)
action=discussiontoolsthank
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Discussion tools
- License: MIT
Send a public thank-you notification for a comment.
- page
The page to perform actions on.
- This parameter is required.
- commentid
ID of the comment to thank.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=echocreateevent
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Manually trigger a notification to a user
- user
User to send the notification to
- Type: user, by any of username and user ID (e.g. "#12345")
- header
Header content of the notification
- This parameter is required.
- Cannot be longer than 160 bytes.
- content
Body content of the notification
- This parameter is required.
- Cannot be longer than 5,000 bytes.
- page
Page to link to in the notification
- Type: page title
- Accepts non-existent pages.
- section
Section where notification would be delivered
- This parameter is required.
- One of the following values: alert, notice
- Default: notice
Whether to send an email as well
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send a notification
- api.php?action=echocreateevent&header=Hi&content=From_API [open in sandbox]
action=echomarkread
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Mark notifications as read for the current user.
- list
A list of notification IDs to mark as read.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- unreadlist
A list of notification IDs to mark as unread.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- all
If set, marks all of a user's notifications as read.
- Type: boolean (details)
- sections
A list of sections to mark as read.
- Values (separate with | or alternative): alert, message
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Mark notification 8 as read
- api.php?action=echomarkread&list=8 [open in sandbox]
- Mark all notifications as read
- api.php?action=echomarkread&all=true [open in sandbox]
- Mark notification 1 as unread
- api.php?action=echomarkread&unreadlist=1 [open in sandbox]
action=echomarkseen
- This module requires read rights.
- Source: Echo
- License: MIT
Mark notifications as seen for the current user.
- type
Type of notifications to mark as seen: 'alert', 'message' or 'all'.
- This parameter is required.
- One of the following values: alert, all, message
- timestampFormat
Timestamp format to use for output, 'ISO_8601' or 'MW'. 'MW' is deprecated here, so all clients should switch to 'ISO_8601'. This parameter will be removed, and 'ISO_8601' will become the only output format.
- One of the following values: ISO_8601, MW
- Default: MW
- Mark notifications of all types as seen
- api.php?action=echomarkseen&type=all [open in sandbox]
action=echomute
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Echo
- License: MIT
Mute or unmute notifications from certain users or pages.
- type
Which mute list to add to or remove from
- This parameter is required.
- One of the following values: page-linked-title, user
- mute
Pages or users to add to the mute list
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- unmute
Pages or users to remove from the mute list
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=edit
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Create and edit pages.
- title
Title of the page to edit. Cannot be used together with pageid.
- pageid
Page ID of the page to edit. Cannot be used together with title.
- Type: integer
- section
Section identifier. 0 for the top section, new for a new section. Often a positive integer, but can also be non-numeric.
- sectiontitle
The title for a new section when using section=new.
- text
Page content.
- summary
Edit summary.
When this parameter is not provided or empty, an edit summary may be generated automatically.
When using section=new and sectiontitle is not provided, the value of this parameter is used for the section title instead, and an edit summary is generated automatically.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- minor
Mark this edit as a minor edit.
- Type: boolean (details)
- notminor
Do not mark this edit as a minor edit even if the "Mark all edits minor by default" user preference is set.
- Type: boolean (details)
- bot
Mark this edit as a bot edit.
- Type: boolean (details)
- baserevid
ID of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions. Self-conflicts cause the edit to fail unless basetimestamp is set.
- Type: integer
- basetimestamp
Timestamp of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions&rvprop=timestamp. Self-conflicts are ignored.
- Type: timestamp (allowed formats)
- starttimestamp
Timestamp when the editing process began, used to detect edit conflicts. An appropriate value may be obtained using curtimestamp when beginning the edit process (e.g. when loading the page content to edit).
- Type: timestamp (allowed formats)
- recreate
Override any errors about the page having been deleted in the meantime.
- Type: boolean (details)
- createonly
Don't edit the page if it already exists.
- Type: boolean (details)
- nocreate
Throw an error if the page doesn't exist.
- Type: boolean (details)
- watch
- Deprecated.
Add the page to the current user's watchlist.
- Type: boolean (details)
- unwatch
- Deprecated.
Remove the page from the current user's watchlist.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- md5
The MD5 hash of the text parameter, or the prependtext and appendtext parameters concatenated. If set, the edit won't be done unless the hash is correct.
- prependtext
Add this text to the beginning of the page or section. Overrides text.
- appendtext
Add this text to the end of the page or section. Overrides text.
Use section=new to append a new section, rather than this parameter.
- undo
Undo this revision. Overrides text, prependtext and appendtext.
- Type: integer
- The value must be no less than 0.
- undoafter
Undo all revisions from undo to this one. If not set, just undo one revision.
- Type: integer
- The value must be no less than 0.
- redirect
Automatically resolve redirects.
- Type: boolean (details)
- contentformat
Content serialization format used for the input text.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- contentmodel
Content model of the new content.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- token
A "csrf" token retrieved from action=query&meta=tokens
The token should always be sent as the last parameter, or at least after the text parameter.
- This parameter is required.
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- discussiontoolsautosubscribe
Automatically subscribe the user to any new talk page threads created by the edit. Use 'yes' or 'no' to override a user's preference (the default).
- One of the following values: no, preferences, yes
- Default: preferences
- captchaword
Answer to the CAPTCHA
- captchaid
CAPTCHA ID from previous request
- Edit a page.
- api.php?action=edit&title=Test&summary=test%20summary&text=article%20content&baserevid=1234567&token=123ABC [open in sandbox]
- Prepend __NOTOC__ to a page.
- api.php?action=edit&title=Test&summary=NOTOC&minor=&prependtext=__NOTOC__%0A&basetimestamp=2007-08-24T12:34:54Z&token=123ABC [open in sandbox]
- Undo revisions 13579 through 13585 with autosummary.
- api.php?action=edit&title=Test&undo=13585&undoafter=13579&basetimestamp=2007-08-24T12:34:54Z&token=123ABC [open in sandbox]
action=editcheckreferenceurl
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: VisualEditor
- License: MIT
Check the status of a URL for use as a reference.
- url
URL to check.
- This parameter is required.
action=emailuser
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Email a user.
- target
User to send the email to.
- This parameter is required.
- subject
Subject header.
- This parameter is required.
- text
Email body.
- This parameter is required.
- ccme
Send a copy of this mail to me.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send an email to the user WikiSysop with the text Content.
- api.php?action=emailuser&target=WikiSysop&text=Content&token=123ABC [open in sandbox]
action=expandtemplates
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Expands all templates within wikitext.
- title
Title of the page.
- text
Wikitext to convert.
- This parameter is required.
- revid
Revision ID, for
{{REVISIONID}}and similar variables.- Type: integer
- prop
Which pieces of information to get.
Note that if no values are selected, the result will contain the wikitext, but the output will be in a deprecated format.
- wikitext
- The expanded wikitext.
- categories
- Any categories present in the input that are not represented in the wikitext output.
- properties
- Page properties defined by expanded magic words in the wikitext.
- volatile
- Whether the output is volatile and should not be reused elsewhere within the page.
- ttl
- The maximum time after which caches of the result should be invalidated.
- modules
- Any ResourceLoader modules that parser functions have requested be added to the output. Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules.
- jsconfigvars
- Gives the JavaScript configuration variables specific to the page.
- encodedjsconfigvars
- Gives the JavaScript configuration variables specific to the page as a JSON string.
- parsetree
- The XML parse tree of the input.
- Values (separate with | or alternative): categories, encodedjsconfigvars, jsconfigvars, modules, parsetree, properties, ttl, volatile, wikitext
- includecomments
Whether to include HTML comments in the output.
- Type: boolean (details)
- showstrategykeys
Whether to include internal merge strategy information in jsconfigvars.
- Type: boolean (details)
- generatexml
- Deprecated.
Generate XML parse tree (replaced by prop=parsetree).
- Type: boolean (details)
- Expand the wikitext {{Project:Sandbox}}.
- api.php?action=expandtemplates&text={{Project:Sandbox}} [open in sandbox]
action=feedcontributions
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns a user's contributions feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- user
What users to get the contributions for.
- This parameter is required.
- Type: user, by any of username, IP, Temporary user, IP range, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- namespace
Which namespace to filter the contributions by.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- year
From year (and earlier).
- Type: integer
- month
From month (and earlier).
- Type: integer
- tagfilter
Filter contributions that have these tags.
- Values (separate with | or alternative): abusefilter-condition-limit, discussiontools, discussiontools-added-comment, discussiontools-edit, discussiontools-newtopic, discussiontools-reply, discussiontools-source, discussiontools-source-enhanced, discussiontools-visual, editcheck-newcontent, editcheck-newreference, editcheck-paste-shown, editcheck-reference-decline-common-knowledge, editcheck-reference-decline-irrelevant, editcheck-reference-decline-other, editcheck-reference-decline-uncertain, editcheck-references, editcheck-references-activated, editcheck-references-shown, editcheck-tone, editcheck-tone-shown, editsuggestion-seen, editsuggestion-used, mw-blank, mw-changed-redirect-target, mw-contentmodelchange, mw-edited-other-users-js, mw-ipblock-appeal, mw-manual-revert, mw-new-redirect, mw-recreated, mw-removed-redirect, mw-replace, mw-reverted, mw-rollback, mw-server-side-upload, mw-undo, nuke, replacetext, visualeditor, visualeditor-needcheck, visualeditor-switched, visualeditor-wikitext, wikieditor
- Default: (empty)
- deletedonly
Show only deleted contributions.
- Type: boolean (details)
- toponly
Only show edits that are the latest revisions.
- Type: boolean (details)
- newonly
Only show edits that are page creations.
- Type: boolean (details)
- hideminor
Hide minor edits.
- Type: boolean (details)
- showsizediff
Show the size difference between revisions.
- Type: boolean (details)
- Return contributions for user Example.
- api.php?action=feedcontributions&user=Example [open in sandbox]
action=feedrecentchanges
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns a recent changes feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- namespace
Namespace to limit the results to.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- invert
All namespaces but the selected one.
- Type: boolean (details)
- associated
Include associated (talk or main) namespace.
- Type: boolean (details)
- days
Days to limit the results to.
- Type: integer
- The value must be no less than 1.
- Default: 7
- limit
Maximum number of results to return.
- Type: integer
- The value must be between 1 and 50.
- Default: 50
- from
Show changes since then.
- Type: timestamp (allowed formats)
- hideminor
Hide minor changes.
- Type: boolean (details)
- hidebots
Hide changes made by bots.
- Type: boolean (details)
- hideanons
Hide changes made by anonymous users and temporary accounts.
- Type: boolean (details)
- hideliu
Hide changes made by registered users.
- Type: boolean (details)
- hidepatrolled
Hide patrolled changes.
- Type: boolean (details)
- hidemyself
Hide changes made by the current user.
- Type: boolean (details)
- hidecategorization
Hide category membership changes.
- Type: boolean (details)
- tagfilter
Filter by tag.
All edits except ones tagged with the selected ones.
- Type: boolean (details)
- target
Show only changes on pages linked from this page.
- showlinkedto
Show changes on pages linked to the selected page instead.
- Type: boolean (details)
- Show recent changes.
- api.php?action=feedrecentchanges [open in sandbox]
- Show recent changes for 30 days.
- api.php?action=feedrecentchanges&days=30 [open in sandbox]
action=feedwatchlist
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns a watchlist feed.
- feedformat
The format of the feed.
- One of the following values: atom, rss
- Default: rss
- hours
List pages modified within this many hours from now.
- Type: integer
- The value must be between 1 and 72.
- Default: 24
- linktosections
Link directly to changed sections if possible.
- Type: boolean (details)
- allrev
Include multiple revisions of the same page within given timeframe.
- Type: boolean (details)
- wlowner
Used along with token to access a different user's watchlist.
- Type: user, by username
- wltoken
A security token (available in the user's preferences) to allow access to another user's watchlist.
- wlshow
Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set show=minor|!anon.
- Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !unread, anon, autopatrolled, bot, minor, patrolled, unread
- wltype
Which types of changes to show:
- edit
- Regular page edits.
- new
- Page creations.
- log
- Log entries.
- external
- External changes.
- categorize
- Category membership changes.
- Values (separate with | or alternative): categorize, edit, external, log, new
- Default: edit|new|log|categorize
- wlexcludeuser
Don't list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- Show the watchlist feed.
- api.php?action=feedwatchlist [open in sandbox]
- Show all changes to watched pages in the past 6 hours.
- api.php?action=feedwatchlist&allrev=&hours=6 [open in sandbox]
action=filerevert
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Revert a file to an old version.
- filename
Target filename, without the File: prefix.
- This parameter is required.
- comment
Upload comment.
- Default: (empty)
- archivename
Archive name of the revision to revert to.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Revert Wiki.png to the version of 2011-03-05T15:27:40Z.
- api.php?action=filerevert&filename=Wiki.png&comment=Revert&archivename=20110305152740!Wiki.png&token=123ABC [open in sandbox]
action=help
- Source: MediaWiki
- License: GPL-2.0-or-later
Display help for the specified modules.
- modules
Modules to display help for (values of the action and format parameters, or main). Can specify submodules with a +.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: main
- submodules
Include help for submodules of the named module.
- Type: boolean (details)
- recursivesubmodules
Include help for submodules recursively.
- Type: boolean (details)
- wrap
Wrap the output in a standard API response structure.
- Type: boolean (details)
- toc
Include a table of contents in the HTML output.
- Type: boolean (details)
- Help for the main module.
- api.php?action=help [open in sandbox]
- Help for action=query and all its submodules.
- api.php?action=help&modules=query&submodules=1 [open in sandbox]
- All help in one page.
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
- Help for the help module itself.
- api.php?action=help&modules=help [open in sandbox]
- Help for two query submodules.
- api.php?action=help&modules=query+info|query+categorymembers [open in sandbox]
action=imagerotate
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Rotate one or more images.
- rotation
Degrees to rotate image clockwise.
- This parameter is required.
- One of the following values: 90, 180, 270
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
Tags to apply to the entry in the upload log.
- Values (separate with | or alternative):
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Rotate File:Example.png by 90 degrees.
- api.php?action=imagerotate&titles=File:Example.jpg&rotation=90&token=123ABC [open in sandbox]
- Rotate all images in Category:Flip by 180 degrees.
- api.php?action=imagerotate&generator=categorymembers&gcmtitle=Category:Flip&gcmtype=file&rotation=180&token=123ABC [open in sandbox]
action=import
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Import a page from another wiki, or from an XML file.
Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending a file for the xml parameter.
- summary
Log entry import summary.
- xml
Uploaded XML file.
- Must be posted as a file upload using multipart/form-data.
- interwikiprefix
For uploaded imports: interwiki prefix to apply to unknown usernames (and known users if assignknownusers is set).
- interwikisource
For interwiki imports: wiki to import from.
- One of the following values:
- interwikipage
For interwiki imports: page to import.
- fullhistory
For interwiki imports: import the full history, not just the current version.
- Type: boolean (details)
- templates
For interwiki imports: import all included templates as well.
- Type: boolean (details)
- namespace
Import to this namespace. Cannot be used together with rootpage.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- assignknownusers
Assign edits to local users where the named user exists locally.
- Type: boolean (details)
- rootpage
Import as subpage of this page. Cannot be used together with namespace.
Change tags to apply to the entry in the import log and to the dummy revision on the imported pages.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Import meta:Help:ParserFunctions to namespace 100 with full history.
- api.php?action=import&interwikisource=meta&interwikipage=Help:ParserFunctions&namespace=100&fullhistory=&token=123ABC [open in sandbox]
action=languagesearch
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Search for language names in any script.
- search
Search string.
- This parameter is required.
- typos
Number of spelling mistakes allowed in the search string.
- Type: integer
- Default: 1
- Search for "Te"
- api.php?action=languagesearch&search=Te [open in sandbox]
- Search for "ഫി"
- api.php?action=languagesearch&search=ഫി [open in sandbox]
- Search for "ഫി", allowing one typo
- api.php?action=languagesearch&search=ഫി&typos=1 [open in sandbox]
action=linkaccount (link)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Link an account from a third-party provider to the current user.
The general procedure to use this module is:
- Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=link, and a csrf token from action=query&meta=tokens.
- Present the fields to the user, and obtain their submission.
- Post to this module, supplying linkreturnurl and any relevant fields.
- Check the status in the response.
- If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
- If you received UI, present the new fields to the user and obtain their submission. Then post to this module with linkcontinue and the relevant fields set, and repeat step 4.
- If you received REDIRECT, direct the user to the redirecttarget and wait for the return to linkreturnurl. Then post to this module with linkcontinue and any fields passed to the return URL, and repeat step 4.
- If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
- linkrequests
Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=link or from a previous response from this module.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- linkmessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- linkmergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- linkreturnurl
Return URL for third-party authentication flows, must be absolute. Either this or linkcontinue is required.
Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a linkcontinue request to this API module.
- linkcontinue
This request is a continuation after an earlier UI or REDIRECT response. Either this or linkreturnurl is required.
- Type: boolean (details)
- linktoken
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- *
- This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=link (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
- Start the process of linking to an account from Example.
- api.php?action=linkaccount&provider=Example&linkreturnurl=http://example.org/&linktoken=123ABC [open in sandbox]
action=login (lg)
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Log in and get authentication cookies.
This action should only be used in combination with Special:BotPasswords; use for main-account login is deprecated and may fail without warning. To safely log in to the main account, use action=clientlogin.
- lgname
Username.
- lgpassword
Password.
- lgdomain
Domain (optional).
- lgtoken
A "login" token retrieved from action=query&meta=tokens
action=logout
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Log out and clear session data.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- checkuserclienthints
Client hints data supplied alongside requests to ApiLogout. For internal use only.
- Log the current user out.
- api.php?action=logout&token=123ABC [open in sandbox]
action=managetags
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Perform management tasks relating to change tags.
Which operation to perform:
- create
- Create a new change tag for manual use.
- delete
- Remove a change tag from the database, including removing the tag from all revisions, recent change entries and log entries on which it is used.
- activate
- Activate a change tag, allowing users to apply it manually.
- deactivate
- Deactivate a change tag, preventing users from applying it manually.
- This parameter is required.
- One of the following values: activate, create, deactivate, delete
Tag to create, delete, activate or deactivate. For tag creation, the tag must not exist. For tag deletion, the tag must exist. For tag activation, the tag must exist and not be in use by an extension. For tag deactivation, the tag must be currently active and manually defined.
- This parameter is required.
An optional reason for creating, deleting, activating or deactivating the tag.
- Default: (empty)
Whether to ignore any warnings that are issued during the operation.
- Type: boolean (details)
Change tags to apply to the entry in the tag management log.
- Values (separate with | or alternative):
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Create a tag named spam with the reason For use in edit patrolling
- api.php?action=managetags&operation=create&tag=spam&reason=For+use+in+edit+patrolling&token=123ABC [open in sandbox]
- Delete the vandlaism tag with the reason Misspelt
- api.php?action=managetags&operation=delete&tag=vandlaism&reason=Misspelt&token=123ABC [open in sandbox]
- Activate a tag named spam with the reason For use in edit patrolling
- api.php?action=managetags&operation=activate&tag=spam&reason=For+use+in+edit+patrolling&token=123ABC [open in sandbox]
- Deactivate a tag named spam with the reason No longer required
- api.php?action=managetags&operation=deactivate&tag=spam&reason=No+longer+required&token=123ABC [open in sandbox]
action=mergehistory
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Merge page histories.
- from
Title of the page from which history will be merged. Cannot be used together with fromid.
- fromid
Page ID of the page from which history will be merged. Cannot be used together with from.
- Type: integer
- to
Title of the page to which history will be merged. Cannot be used together with toid.
- toid
Page ID of the page to which history will be merged. Cannot be used together with to.
- Type: integer
- timestamp
Timestamp up to which revisions will be moved from the source page's history to the destination page's history. If omitted, the entire page history of the source page will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.
- reason
Reason for the history merge.
- Default: (empty)
- starttimestamp
Timestamp from which revisions will be moved from the source page's history to the destination page's history. If omitted, all revisions before the timestamp parameter (or the entire history if neither are specified) will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Merge the entire history of Oldpage into Newpage.
- api.php?action=mergehistory&from=Oldpage&to=Newpage&token=123ABC&reason=Reason [open in sandbox]
- Merge the page revisions of Oldpage dating up to 2015-12-31T04:37:41Z into Newpage.
- api.php?action=mergehistory&from=Oldpage&to=Newpage&token=123ABC&reason=Reason×tamp=2015-12-31T04%3A37%3A41Z [open in sandbox]
action=move
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Move a page.
- from
Title of the page to rename. Cannot be used together with fromid.
- fromid
Page ID of the page to rename. Cannot be used together with from.
- Type: integer
- to
Title to rename the page to.
- This parameter is required.
- reason
Reason for the rename.
- Default: (empty)
- movetalk
Rename the talk page, if it exists.
- Type: boolean (details)
- movesubpages
Rename subpages, if applicable.
- Type: boolean (details)
- noredirect
Don't create a redirect.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- ignorewarnings
Ignore any warnings.
- Type: boolean (details)
Change tags to apply to the entry in the move log and to the dummy revision on the destination page.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Move Badtitle to Goodtitle without leaving a redirect.
- api.php?action=move&from=Badtitle&to=Goodtitle&token=123ABC&reason=Misspelled%20title&movetalk=&noredirect= [open in sandbox]
action=opensearch
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Search the wiki using the OpenSearch protocol.
- search
Search string.
- This parameter is required.
- namespace
Namespaces to search. Ignored if search begins with a valid namespace prefix.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- Default: 0
- limit
Maximum number of results to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- suggest
- Deprecated.
No longer used.
- Type: boolean (details)
- redirects
How to handle redirects:
- return
- Return the redirect itself.
- resolve
- Return the target page. May return fewer than limit results.
For historical reasons, the default is "return" for format=json and "resolve" for other formats.
- One of the following values: resolve, return
- format
The format of the output.
- One of the following values: json, jsonfm, xml, xmlfm
- Default: json
- warningsaserror
If warnings are raised with format=json, return an API error instead of ignoring them.
- Type: boolean (details)
- Find pages beginning with Te.
- api.php?action=opensearch&search=Te [open in sandbox]
action=options
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change preferences of the current user.
Only options which are registered in core or in one of installed extensions, or options with keys prefixed with userjs- (intended to be used by user scripts), can be set.
- reset
Resets preferences to the site defaults.
- Type: boolean (details)
- resetkinds
List of types of options to reset when the reset option is set.
- Values (separate with | or alternative): all, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
- Default: all
- change
List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., optionname|otheroption|..., the option will be reset to its default value. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- optionname
The name of the option that should be set to the value given by optionvalue.
- optionvalue
The value for the option specified by optionname. When optionname is set but optionvalue is omitted, the option will be reset to its default value.
- global
What to do if the option was set globally using the GlobalPreferences extension.
- ignore: Do nothing. The option remains with its previous value.
- override: Add a local override.
- update: Update the option globally.
- create: Set the option globally, overriding any local value.
- One of the following values: create, ignore, override, update
- Default: ignore
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Reset all preferences.
- api.php?action=options&reset=&token=123ABC [open in sandbox]
- Change skin and hideminor preferences.
- api.php?action=options&change=skin=vector|hideminor=1&token=123ABC [open in sandbox]
- Reset all preferences, then set skin and nickname.
- api.php?action=options&reset=&change=skin=monobook&optionname=nickname&optionvalue=[[User:Beau|Beau]]%20([[User_talk:Beau|talk]])&token=123ABC [open in sandbox]
action=paraminfo
- Source: MediaWiki
- License: GPL-2.0-or-later
Obtain information about API modules.
- modules
List of module names (values of the action and format parameters, or main). Can specify submodules with a +, or all submodules with +*, or all submodules recursively with +**.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- helpformat
Format of help strings.
- One of the following values: html, none, raw, wikitext
- Default: none
- querymodules
- Deprecated.
List of query module names (value of prop, meta or list parameter). Use modules=query+foo instead of querymodules=foo.
- Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allmessages, allpages, allredirects, allrevisions, alltransclusions, allusers, authmanagerinfo, backlinks, blocks, categories, categoryinfo, categorymembers, checkuser, checkuserformattedblockinfo, checkuserlog, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, codexicons, contributors, deletedrevisions, deletedrevs, description, duplicatefiles, embeddedin, entityterms, extlinks, extracts, exturlusage, filearchive, filerepoinfo, fileusage, gadgetcategories, gadgets, imageinfo, images, imageusage, info, iwbacklinks, iwlinks, langbacklinks, langlinks, languageinfo, links, linkshere, linterrors, linterstats, logevents, mystashedfiles, notifications, pageimages, pagepropnames, pageprops, pageswithprop, pageterms, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, siteinfo, stashimageinfo, tags, templates, tokens, trackingcategories, transcludedin, unreadnotificationpages, usercontribs, userinfo, users, watchlist, watchlistraw, wbcontentlanguages, wbentityusage, wblistentityusage, wbsearch, wbsubscribers, wikibase
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- mainmodule
- Deprecated.
Get information about the main (top-level) module as well. Use modules=main instead.
- pagesetmodule
- Deprecated.
Get information about the pageset module (providing titles= and friends) as well.
- formatmodules
- Deprecated.
List of format module names (value of format parameter). Use modules instead.
- Values (separate with | or alternative): json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
- Show info for action=parse, format=jsonfm, action=query&list=allpages, and action=query&meta=siteinfo.
- api.php?action=paraminfo&modules=parse|phpfm|query%2Ballpages|query%2Bsiteinfo [open in sandbox]
- Show info for all submodules of action=query.
- api.php?action=paraminfo&modules=query%2B* [open in sandbox]
action=parse
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Parses content and returns parser output.
See the various prop-modules of action=query to get information from the current version of a page.
There are several ways to specify the text to parse:
- Specify a page or revision, using page, pageid, or oldid.
- Specify content explicitly, using text, title, revid, and contentmodel.
- Specify only a summary to parse. prop should be given an empty value.
- title
Title of page the text belongs to. If omitted, contentmodel must be specified, and API will be used as the title.
- text
Text to parse. Use title or contentmodel to control the content model.
- revid
Revision ID, for
{{REVISIONID}}and similar variables.- Type: integer
- summary
Summary to parse.
- page
Parse the content of this page. Cannot be used together with text and title.
- pageid
Parse the content of this page. Overrides page.
- Type: integer
- redirects
If page or pageid is set to a redirect, resolve it.
- Type: boolean (details)
- oldid
Parse the content of this revision. Overrides page and pageid.
- Type: integer
- prop
Which pieces of information to get:
- text
- Gives the parsed text of the wikitext.
- langlinks
- Gives the language links in the parsed wikitext.
- categories
- Gives the categories in the parsed wikitext.
- categorieshtml
- Gives the HTML version of the categories.
- links
- Gives the internal links in the parsed wikitext.
- templates
- Gives the templates in the parsed wikitext.
- images
- Gives the images in the parsed wikitext.
- externallinks
- Gives the external links in the parsed wikitext.
- sections
- Deprecated. prop=sections has been deprecated. Please use prop=tocdata instead.Gives the sections in the parsed wikitext.
- tocdata
- Gives the table of contents information in the parsed wikitext. See mw:API:Parsing_wikitext/TOCData for schema.
- revid
- Adds the revision ID of the parsed page.
- displaytitle
- Adds the title of the parsed wikitext.
- subtitle
- Adds the page subtitle for the parsed page.
- headhtml
- Gives parsed doctype, opening
<html>,<head>element and opening<body>of the page. - modules
- Gives the ResourceLoader modules used on the page. To load, use
mw.loader.using(). Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules. - jsconfigvars
- Gives the JavaScript configuration variables specific to the page. To apply, use
mw.config.set(). - encodedjsconfigvars
- Gives the JavaScript configuration variables specific to the page as a JSON string.
- indicators
- Gives the HTML of page status indicators used on the page.
- iwlinks
- Gives interwiki links in the parsed wikitext.
- wikitext
- Gives the original wikitext that was parsed.
- properties
- Gives various properties defined in the parsed wikitext.
- limitreportdata
- Gives the limit report in a structured way. Gives no data, when disablelimitreport is set.
- limitreporthtml
- Gives the HTML version of the limit report. Gives no data, when disablelimitreport is set.
- parsetree
- The XML parse tree of revision content (requires content model
wikitext) - parsewarnings
- Gives the warnings that occurred while parsing content (as wikitext).
- parsewarningshtml
- Gives the warnings that occurred while parsing content (as HTML).
- headitems
- Deprecated. prop=headitems is deprecated since MediaWiki 1.28. Use prop=headhtml when creating new HTML documents, or prop=modules|jsconfigvars when updating a document client-side.Gives items to put in the
<head>of the page.
- Values (separate with | or alternative): categories, categorieshtml, displaytitle, encodedjsconfigvars, externallinks, headhtml, images, indicators, iwlinks, jsconfigvars, langlinks, limitreportdata, limitreporthtml, links, modules, parsetree, parsewarnings, parsewarningshtml, properties, revid, subtitle, templates, text, tocdata, wikitext, headitems, sections
- Default: text|langlinks|categories|links|templates|images|externallinks|sections|tocdata|revid|displaytitle|iwlinks|properties|parsewarnings
- wrapoutputclass
CSS class to use to wrap the parser output.
- Default: mw-parser-output
- usearticle
Use the ArticleParserOptions hook to ensure the options used match those used for article page views
- Type: boolean (details)
- parsoid
- Deprecated.
Generate HTML conforming to the MediaWiki DOM spec using Parsoid. Replaced by parser=parsoid.
- Type: boolean (details)
- parser
Which wikitext parser to use:
- parsoid
- Generate HTML conforming to the MediaWiki DOM spec using Parsoid.
- default
- Generate HTML using this wiki's default parser.
- legacy
- Generate HTML using the legacy parser.
- One of the following values: default, legacy, parsoid
- Default: default
- pst
Do a pre-save transform on the input before parsing it. Only valid when used with text.
- Type: boolean (details)
- onlypst
Do a pre-save transform (PST) on the input, but don't parse it. Returns the same wikitext, after a PST has been applied. Only valid when used with text.
- Type: boolean (details)
- effectivelanglinks
- Deprecated.
Includes language links supplied by extensions (for use with prop=langlinks).
- Type: boolean (details)
- section
Only parse the content of the section with this identifier.
When new, parse text and sectiontitle as if adding a new section to the page.
new is allowed only when specifying text.
- sectiontitle
New section title when section is new.
Unlike page editing, this does not fall back to summary when omitted or empty.
- disablepp
- Deprecated.
Use disablelimitreport instead.
- Type: boolean (details)
- disablelimitreport
Omit the limit report ("NewPP limit report") from the parser output.
- Type: boolean (details)
- disableeditsection
Omit edit section links from the parser output.
- Type: boolean (details)
- disablestylededuplication
Do not deduplicate inline stylesheets in the parser output.
- Type: boolean (details)
- showstrategykeys
Whether to include internal merge strategy information in jsconfigvars.
- Type: boolean (details)
- generatexml
- Deprecated.
Generate XML parse tree (requires content model
wikitext; replaced by prop=parsetree).- Type: boolean (details)
- preview
Parse in preview mode.
- Type: boolean (details)
- sectionpreview
Parse in section preview mode (enables preview mode too).
- Type: boolean (details)
- disabletoc
Omit table of contents in output.
- Type: boolean (details)
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
- contentformat
Content serialization format used for the input text. Only valid when used with text.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- contentmodel
Content model of the input text. If omitted, title must be specified, and default will be the model of the specified title. Only valid when used with text.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- Parse a page.
- api.php?action=parse&page=Project:Sandbox [open in sandbox]
- Parse wikitext.
- api.php?action=parse&text={{Project:Sandbox}}&contentmodel=wikitext [open in sandbox]
- Parse wikitext, specifying the page title.
- api.php?action=parse&text={{PAGENAME}}&title=Test [open in sandbox]
- Parse a summary.
- api.php?action=parse&summary=Some+[[link]]&prop= [open in sandbox]
action=patrol
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Patrol a page or revision.
- rcid
Recentchanges ID to patrol.
- Type: integer
- revid
Revision ID to patrol.
- Type: integer
Change tags to apply to the entry in the patrol log.
- Values (separate with | or alternative):
- token
A "patrol" token retrieved from action=query&meta=tokens
- This parameter is required.
- Patrol a recent change.
- api.php?action=patrol&token=123ABC&rcid=230672766 [open in sandbox]
- Patrol a revision.
- api.php?action=patrol&token=123ABC&revid=230672766 [open in sandbox]
action=protect
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change the protection level of a page.
- title
Title of the page to (un)protect. Cannot be used together with pageid.
- pageid
ID of the page to (un)protect. Cannot be used together with title.
- Type: integer
- protections
List of protection levels, formatted action=level (e.g. edit=sysop). A level of all means everyone is allowed to take the action, i.e. no restriction.
Note: Any actions not listed will have restrictions removed.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- expiry
Expiry timestamps. If only one timestamp is set, it'll be used for all protections. Use infinite, indefinite, infinity, or never, for a never-expiring protection.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: infinite
- reason
Reason for (un)protecting.
- Default: (empty)
Change tags to apply to the entry in the protection log.
- Values (separate with | or alternative):
- cascade
Enable cascading protection (i.e. protect transcluded templates and images used in this page). Ignored if none of the given protection levels support cascading.
- Type: boolean (details)
- watch
- Deprecated.
If set, add the page being (un)protected to the current user's watchlist.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Protect a page.
- api.php?action=protect&title=Main%20Page&token=123ABC&protections=edit=sysop|move=sysop&cascade=&expiry=20070901163000|never [open in sandbox]
- Unprotect a page by setting restrictions to all (i.e. everyone is allowed to take the action).
- api.php?action=protect&title=Main%20Page&token=123ABC&protections=edit=all|move=all&reason=Lifting%20restrictions [open in sandbox]
- Unprotect a page by setting no restrictions.
- api.php?action=protect&title=Main%20Page&token=123ABC&protections=&reason=Lifting%20restrictions [open in sandbox]
action=purge
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Purge the cache for the given titles.
- forcelinkupdate
Update the links tables and do other secondary data updates.
- Type: boolean (details)
- forcerecursivelinkupdate
Same as forcelinkupdate, and update the links tables for any page that uses this page as a template.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Purge Main Page and the API page.
- api.php?action=purge&titles=Main%20Page|API [open in sandbox]
- Purge the first 10 pages in the main namespace.
- api.php?action=purge&generator=allpages&gapnamespace=0&gaplimit=10 [open in sandbox]
action=query
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Fetch data from and about MediaWiki.
All data modifications will first have to use query to acquire a token to prevent abuse from malicious sites.
- prop
Which properties to get for the queried pages.
- categories
- List all categories the pages belong to.
- categoryinfo
- Returns information about the given categories.
- contributors
- Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- entityterms
- Get the terms (labels, descriptions and aliases) of the entity on this page.
- extlinks
- Returns all external URLs (not interwikis) from the given pages.
- extracts
- Returns plain-text or limited HTML extracts of the given pages.
- fileusage
- Find all pages that use the given files.
- imageinfo
- Returns file information and upload history.
- images
- Returns all files contained on the given pages.
- info
- Get basic page information.
- iwlinks
- Returns all interwiki links from the given pages.
- langlinks
- Returns all interlanguage links from the given pages.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageimages
- Returns information about images on the page, such as thumbnail and presence of photos.
- pageprops
- Get various page properties defined in the page content.
- pageterms
- Get the MonoCloud Wiki terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- stashimageinfo
- Returns file information for stashed files.
- templates
- Returns all pages transcluded on the given pages.
- transcludedin
- Find all pages that transclude the given pages.
- wbentityusage
- Returns all entity IDs used in the given pages.
- cirrusbuilddoc
- Internal. Dump of a CirrusSearch article document from the database servers
- cirruscompsuggestbuilddoc
- Internal. Dump of the document used by the completion suggester
- cirrusdoc
- Internal. Dump of a CirrusSearch article document from the search servers
- description
- Internal. Get a short description a.k.a. subtitle explaining what the target page is about.
- Values (separate with | or alternative): categories, categoryinfo, contributors, deletedrevisions, duplicatefiles, entityterms, extlinks, extracts, fileusage, imageinfo, images, info, iwlinks, langlinks, links, linkshere, pageimages, pageprops, pageterms, redirects, revisions, stashimageinfo, templates, transcludedin, wbentityusage, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, description
- list
Which lists to get.
- abusefilters
- Show details of the abuse filters.
- abuselog
- Show events that were caught by one of the abuse filters.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- allusers
- Enumerate all registered users.
- backlinks
- Find all pages that link to the given page.
- blocks
- List all blocked users and IP addresses.
- categorymembers
- List all pages in a given category.
- checkuserlog
- Get entries from the CheckUser log.
- codexicons
- Get Codex icons
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- filearchive
- Enumerate all deleted files sequentially.
- gadgetcategories
- Returns a list of gadget sections.
- gadgets
- Returns a list of gadgets used on this wiki.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- linterrors
- Get a list of lint errors
- logevents
- Get events from logs.
- mystashedfiles
- Get a list of files in the current user's upload stash.
- pagepropnames
- List all page property names in use on the wiki.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- search
- Perform a full text search.
- tags
- List change tags.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- usercontribs
- Get all edits by a user.
- users
- Get information about a list of users.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsubscribers
- Get subscriptions to given entities.
- checkuser
- Deprecated. This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
- deletedrevs
- Deprecated. list=deletedrevs has been deprecated. Please use prop=deletedrevisions or list=alldeletedrevisions instead.List deleted revisions.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, allusers, backlinks, blocks, categorymembers, checkuserlog, codexicons, embeddedin, exturlusage, filearchive, gadgetcategories, gadgets, imageusage, iwbacklinks, langbacklinks, linterrors, logevents, mystashedfiles, pagepropnames, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, search, tags, trackingcategories, usercontribs, users, watchlist, watchlistraw, wblistentityusage, wbsubscribers, checkuser, deletedrevs, wbsearch
- meta
Which metadata to get.
- allmessages
- Return messages from this site.
- authmanagerinfo
- Retrieve information about the current authentication status.
- filerepoinfo
- Return meta information about image repositories configured on the wiki.
- languageinfo
- Return information about available languages.
- linterstats
- Get number of lint errors in each category
- notifications
- Get notifications waiting for the current user.
- siteinfo
- Return general information about the site.
- tokens
- Gets tokens for data-modifying actions.
- unreadnotificationpages
- Get pages for which there are unread notifications for the current user.
- userinfo
- Get information about the current user.
- wbcontentlanguages
- Returns information about the content languages Wikibase accepts in different contexts.
- wikibase
- Get information about the Wikibase client and the associated Wikibase repository.
- checkuserformattedblockinfo
- Internal. Return formatted block details for sitewide blocks affecting the current user.
- Values (separate with | or alternative): allmessages, authmanagerinfo, filerepoinfo, languageinfo, linterstats, notifications, siteinfo, tokens, unreadnotificationpages, userinfo, wbcontentlanguages, wikibase, checkuserformattedblockinfo
- indexpageids
Include an additional pageids section listing all returned page IDs.
- Type: boolean (details)
- export
Export the current revisions of all given or generated pages.
- Type: boolean (details)
- exportnowrap
Return the export XML without wrapping it in an XML result (same format as Special:Export). Can only be used with query+export.
- Type: boolean (details)
- exportschema
Target the given version of the XML dump format when exporting. Can only be used with query+export.
- One of the following values: 0.10, 0.11
- Default: 0.11
- iwurl
Whether to get the full URL if the title is an interwiki link.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- rawcontinue
Return raw query-continue data for continuation.
- Type: boolean (details)
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
- redirects
Automatically resolve redirects in query+titles, query+pageids, and query+revids, and in pages returned by query+generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Fetch site info and revisions of Main Page.
- api.php?action=query&prop=revisions&meta=siteinfo&titles=Main%20Page&rvprop=user|comment&continue= [open in sandbox]
- Fetch revisions of pages beginning with API/.
- api.php?action=query&generator=allpages&gapprefix=API/&prop=revisions&continue= [open in sandbox]
prop=categories (cl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all categories the pages belong to.
- clprop
Which additional properties to get for each category:
- sortkey
- Adds the sortkey (hexadecimal string) and sortkey prefix (human-readable part) for the category.
- timestamp
- Adds timestamp of when the category was added.
- hidden
- Tags categories that are hidden with
__HIDDENCAT__.
- Values (separate with | or alternative): hidden, sortkey, timestamp
- clshow
Which kind of categories to show.
- Values (separate with | or alternative): !hidden, hidden
- cllimit
How many categories to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- clcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- clcategories
Only list these categories. Useful for checking whether a certain page is in a certain category.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- cldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get a list of categories the page Albert Einstein belongs to.
- api.php?action=query&prop=categories&titles=Albert%20Einstein [open in sandbox]
- Get information about all categories used in the page Albert Einstein.
- api.php?action=query&generator=categories&titles=Albert%20Einstein&prop=info [open in sandbox]
prop=categoryinfo (ci)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns information about the given categories.
- cicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get information about Category:Foo and Category:Bar.
- api.php?action=query&prop=categoryinfo&titles=Category:Foo|Category:Bar [open in sandbox]
prop=cirrusbuilddoc (cb)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of a CirrusSearch article document from the database servers
- cbbuilders
Type of data to extract
- Values (separate with | or alternative): content, links
- Default: content|links
- cblimiterprofile
Profile to use when limiting the size of the document
- Get a dump of a single CirrusSearch article generated from the database.
- api.php?action=query&prop=cirrusbuilddoc&titles=Main_Page [open in sandbox]
prop=cirruscompsuggestbuilddoc (csb)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of the document used by the completion suggester
- csbmethod
Provide a score method name to be used by the completion suggester
- Default: quality
prop=cirrusdoc (cd)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CirrusSearch
- License: GPL-2.0-or-later
Dump of a CirrusSearch article document from the search servers
- cdincludes
Define which fields should be returned by the search.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: all
- Get a dump of a single CirrusSearch article as currently indexed into search.
- api.php?action=query&prop=cirrusdoc&titles=Main_Page [open in sandbox]
- Get a dump of CirrusSearch settings for this wiki with just the Categories that have been selected using the 'includes' parameter
- api.php?action=query&prop=cirrusdoc&titles=Main_Page&cdincludes=category [open in sandbox]
prop=contributors (pc)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
- pcgroup
Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
- pcexcludegroup
Exclude users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
- pcrights
Only include users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, bigdelete, block, blockemail, bot, browsearchive, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, createaccount, createpage, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editcontentmodel, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, editusercss, edituserjs, edituserjson, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, item-merge, item-redirect, item-term, logentryimport, manage-all-push-subscriptions, managechangetags, markbotedits, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, patrol, patrolmarks, property-create, property-term, protect, read, renameuser, renameuser-global, replacetext, reupload, reupload-own, reupload-shared, rollback, sboverride, sendemail, siteadmin, skipcaptcha, spamblacklistlog, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, titleblacklistlog, unblockself, undelete, unwatchedpages, upload, upload_by_url, userrights, userrights-interwiki, viewmyprivateinfo, viewmywatchlist, viewsuppressed
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pcexcluderights
Exclude users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, bigdelete, block, blockemail, bot, browsearchive, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, createaccount, createpage, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editcontentmodel, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, editusercss, edituserjs, edituserjson, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, item-merge, item-redirect, item-term, logentryimport, manage-all-push-subscriptions, managechangetags, markbotedits, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, patrol, patrolmarks, property-create, property-term, protect, read, renameuser, renameuser-global, replacetext, reupload, reupload-own, reupload-shared, rollback, sboverride, sendemail, siteadmin, skipcaptcha, spamblacklistlog, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, titleblacklistlog, unblockself, undelete, unwatchedpages, upload, upload_by_url, userrights, userrights-interwiki, viewmyprivateinfo, viewmywatchlist, viewsuppressed
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pclimit
How many contributors to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- pccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show contributors to the page Main Page.
- api.php?action=query&prop=contributors&titles=Main%20Page [open in sandbox]
prop=deletedrevisions (drv)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get deleted revision information.
May be used in several ways:
- Get deleted revisions for a set of pages, by setting titles or pageids. Ordered by title and timestamp.
- Get data about a set of deleted revisions by setting their IDs with revids. Ordered by revision ID.
- drvprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, drvlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, drvlimit is enforced to 50.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- drvslots
Which revision slots to return data for, when slot-related properties are included in drvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- drvcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of drvslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- drvlimit
Limit how many revisions will be returned. If drvprop=content, drvprop=parsetree, drvdiffto or drvdifftotext is used, the limit is 50. If drvparse is used, the limit is 1.
- Type: integer or max
- The value must be between 1 and 500.
- drvexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires drvprop=content).
- Type: boolean (details)
- drvgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires drvprop=content).
- Type: boolean (details)
- drvparse
- Deprecated.
Use action=parse instead. Parse revision content (requires drvprop=content). For performance reasons, if this option is used, drvlimit is enforced to 1.
- Type: boolean (details)
- drvsection
Only retrieve the content of the section with this identifier.
- drvdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, drvlimit is enforced to 50.
- drvdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides drvdiffto. If drvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, drvlimit is enforced to 50.
- drvdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with drvdifftotext.
- Type: boolean (details)
- drvcontentformat
- Deprecated.
Serialization format used for drvdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- drvstart
The timestamp to start enumerating from. Ignored when processing a list of revision IDs.
- Type: timestamp (allowed formats)
- drvend
The timestamp to stop enumerating at. Ignored when processing a list of revision IDs.
- Type: timestamp (allowed formats)
- drvdir
In which direction to enumerate:
- newer
- List oldest first. Note: drvstart has to be before drvend.
- older
- List newest first (default). Note: drvstart has to be later than drvend.
- One of the following values: newer, older
- Default: older
- drvtag
Only list revisions tagged with this tag.
- drvuser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drvexcludeuser
Don't list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drvcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List the information for deleted revision 123456.
- api.php?action=query&prop=deletedrevisions&revids=123456 [open in sandbox]
- List the deleted revisions of the pages Main Page and its talk page with content.
- api.php?action=query&prop=deletedrevisions&titles=Main%20Page|Talk%3AMain%20Page&drvslots=*&drvprop=user|comment|content [open in sandbox]
prop=description (desc)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get a short description a.k.a. subtitle explaining what the target page is about.
The description is plain text, on a single line, but otherwise arbitrary (potentially including raw HTML tags, which also should be interpreted as plain text). It must not be used in HTML unescaped!
- desccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Default: 0
- descprefersource
Which description source to prefer if present:
- local
- Local descriptions via
{{SHORTDESC:...}}parser function in the wikitext of the page. - central
- Central descriptions from the associated MonoCloud Wiki item.
- One of the following values: central, local
- Default: local
- Get the description for the page 'London'.
- api.php?action=query&prop=description&titles=London [open in sandbox]
- Get the description for the page 'London', preferring the central description if it exists.
- api.php?action=query&prop=description&titles=London&descprefersource=central [open in sandbox]
prop=duplicatefiles (df)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all files that are duplicates of the given files based on hash values.
- dflimit
How many duplicate files to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- dfcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- dfdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- dflocalonly
Look only for files in the local repository.
- Type: boolean (details)
- Look for duplicates of File:Albert Einstein Head.jpg.
- api.php?action=query&titles=File:Albert_Einstein_Head.jpg&prop=duplicatefiles [open in sandbox]
- Look for duplicates of all files.
- api.php?action=query&generator=allimages&prop=duplicatefiles [open in sandbox]
prop=entityterms (wbet)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get the terms (labels, descriptions and aliases) of the entity on this page.
- wbetcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- wbetlanguage
The language code to get terms in. If not specified, the user language is used.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uselang, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- Default: uselang
- wbetterms
The types of terms to get, e.g. 'description', each returned as an array of strings keyed by their type, e.g. {"description": ["foo"]}. If not specified, all types are returned.
- Values (separate with | or alternative): alias, description, label
- Default: alias|label|description
- Get labels and aliases of item Q84.
- api.php?action=query&prop=entityterms&titles=Q84 [open in sandbox]
prop=extlinks (el)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all external URLs (not interwikis) from the given pages.
- ellimit
How many links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- elcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- elprotocol
Protocol of the URL. If empty and elquery is set, the protocol is http and https. Leave both this and elquery empty to list all external links.
- One of the following values: Can be empty, or bitcoin, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
- Default: (empty)
- elquery
Search string without protocol. Useful for checking whether a certain page contains a certain external url.
- elexpandurl
- Deprecated.
Expand protocol-relative URLs with the canonical protocol.
- Type: boolean (details)
- Get a list of external links on the page Main Page.
- api.php?action=query&prop=extlinks&titles=Main%20Page [open in sandbox]
prop=extracts (ex)
- This module requires read rights.
- Source: TextExtracts
- License: GPL-2.0-or-later
Returns plain-text or limited HTML extracts of the given pages.
- exchars
How many characters to return. Actual text returned might be slightly longer.
- Type: integer
- The value must be between 1 and 1,200.
- exsentences
How many sentences to return.
- Type: integer
- The value must be between 1 and 10.
- exlimit
How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)
- Type: integer or max
- The value must be between 1 and 20.
- Default: 20
- exintro
Return only content before the first section.
- Type: boolean (details)
- explaintext
Return extracts as plain text instead of limited HTML.
- Type: boolean (details)
- exsectionformat
How to format sections in plaintext mode:
- plain
- No formatting.
- wiki
- Wikitext-style formatting (== like this ==).
- raw
- This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
- One of the following values: plain, raw, wiki
- Default: wiki
- excontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Get a 175-character extract
- api.php?action=query&prop=extracts&exchars=175&titles=Therion [open in sandbox]
prop=fileusage (fu)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that use the given files.
- fuprop
Which properties to get:
- pageid
- Page ID of each page.
- title
- Title of each page.
- redirect
- Flag if the page is a redirect.
- Values (separate with | or alternative): pageid, redirect, title
- Default: pageid|title|redirect
- funamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- fushow
Show only items that meet these criteria:
- redirect
- Only show redirects.
- !redirect
- Only show non-redirects.
- Values (separate with | or alternative): !redirect, redirect
- fulimit
How many to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- fucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of pages using File:Example.jpg.
- api.php?action=query&prop=fileusage&titles=File%3AExample.jpg [open in sandbox]
- Get information about pages using File:Example.jpg.
- api.php?action=query&generator=fileusage&titles=File%3AExample.jpg&prop=info [open in sandbox]
prop=imageinfo (ii)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns file information and upload history.
- iiprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- thumbmime
- Adds MIME type of the image thumbnail (requires url and param iiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
- mediatype
- Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- archivename
- Adds the filename of the archive version for non-latest versions. If the file has been revision deleted, a filehidden property will be returned.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- uploadwarning
- Used by the Special:Upload page to get information about an existing file. Not intended for use outside MediaWiki core.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- Values (separate with | or alternative): archivename, badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, thumbmime, timestamp, uploadwarning, url, user, userid
- Default: timestamp|user
- iilimit
How many file revisions to return per file.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 1
- iistart
Timestamp to start listing from.
- Type: timestamp (allowed formats)
- iiend
Timestamp to stop listing at.
- Type: timestamp (allowed formats)
- iiurlwidth
If iiprop=url is set, a URL to an image scaled to this width will be returned. For performance reasons if this option is used, no more than 50 scaled images will be returned.
- Type: integer
- Default: -1
- iiurlheight
Similar to iiurlwidth.
- Type: integer
- Default: -1
- iimetadataversion
Version of metadata to use. If latest is specified, use latest version. Defaults to 1 for backwards compatibility.
- Default: 1
- iiextmetadatalanguage
What language to fetch extmetadata in. This affects both which translation to fetch, if multiple are available, as well as how things like numbers and various values are formatted.
- Default: en
- iiextmetadatamultilang
If translations for extmetadata property are available, fetch all of them.
- Type: boolean (details)
- iiextmetadatafilter
If specified and non-empty, only these keys will be returned for iiprop=extmetadata.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- iiurlparam
A handler specific parameter string. For example, PDFs might use page15-100px. iiurlwidth must be used and be consistent with iiurlparam.
- Default: (empty)
- iibadfilecontexttitle
If badfilecontexttitleprop=badfile is set, this is the page title used when evaluating the MediaWiki:Bad image list
- iicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iilocalonly
Look only for files in the local repository.
- Type: boolean (details)
- Fetch information about the current version of File:Albert Einstein Head.jpg.
- api.php?action=query&titles=File:Albert%20Einstein%20Head.jpg&prop=imageinfo [open in sandbox]
- Fetch information about versions of File:Test.jpg from 2008 and later.
- api.php?action=query&titles=File:Test.jpg&prop=imageinfo&iilimit=50&iiend=2007-12-31T23:59:59Z&iiprop=timestamp|user|url [open in sandbox]
prop=images (im)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all files contained on the given pages.
- imlimit
How many files to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- imcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- imimages
Only list these files. Useful for checking whether a certain page has a certain file.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- imdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get a list of files used on the page Main Page.
- api.php?action=query&prop=images&titles=Main%20Page [open in sandbox]
- Get information about all files used on the page Main Page.
- api.php?action=query&generator=images&titles=Main%20Page&prop=info [open in sandbox]
prop=info (in)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get basic page information.
- inprop
Which additional properties to get:
- protection
- List the protection level of each page.
- talkid
- The page ID of the talk page for each non-talk page.
- watched
- List the watched status of each page.
- watchlistlabels
- List the watchlist labels for each page.
- watchers
- The number of watchers, if allowed.
- visitingwatchers
- The number of watchers of each page who have visited recent edits to that page, if allowed.
- notificationtimestamp
- The watchlist notification timestamp of each page.
- subjectid
- The page ID of the parent page for each talk page.
- associatedpage
- The prefixed title of the associated subject or talk page.
- url
- Gives a full URL, an edit URL, and the canonical URL for each page.
- readable
- Deprecated. Whether the user can read this page. Use intestactions=read instead.
- preload
- Deprecated. Gives the text returned by EditFormPreloadText. Use preloadcontent instead, which supports other kinds of preloaded text too.
- preloadcontent
- Gives the content to be shown in the editor when the page does not exist or while adding a new section.
- editintro
- Gives the intro messages that should be shown to the user while editing this page or revision, as HTML.
- displaytitle
- Gives the manner in which the page title is actually displayed.
- varianttitles
- Gives the display title in all variants of the site content language.
- linkclasses
- Gives the additional CSS classes (e.g. link colors) used for links to this page if they were to appear on the page named by inlinkcontext.
- Values (separate with | or alternative): associatedpage, displaytitle, editintro, linkclasses, notificationtimestamp, preloadcontent, protection, subjectid, talkid, url, varianttitles, visitingwatchers, watched, watchers, watchlistlabels, preload, readable
- inlinkcontext
The context title to use when determining extra CSS classes (e.g. link colors) when inprop contains linkclasses.
- Type: page title
- Accepts non-existent pages.
- Default: Main Page
- indefaultlinkcaption
Whether to consider the links as having a default caption (caption is a suffix of link target and preceded by slash, colon or start-of-string). It can have impact on the returned link classes.
- Type: boolean (details)
- intestactions
Test whether the current user can perform certain actions on the page.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- intestactionsdetail
Detail level for intestactions. Use the main module's errorformat and errorlang parameters to control the format of the messages returned.
- boolean
- Return a boolean value for each action.
- full
- Return messages describing why the action is disallowed, or an empty array if it is allowed.
- quick
- Like full but skipping expensive checks.
- One of the following values: boolean, full, quick
- Default: boolean
- intestactionsautocreate
Test whether performing intestactions would automatically create a temporary account.
- Type: boolean (details)
- inpreloadcustom
Title of a custom page to use as preloaded content.
- Only used when inprop contains preloadcontent.
- inpreloadparams
Parameters for the custom page being used as preloaded content.
- Only used when inprop contains preloadcontent.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- inpreloadnewsection
Return preloaded content for a new section on the page, rather than a new page.
- Only used when inprop contains preloadcontent.
- Type: boolean (details)
- ineditintrostyle
Some intro messages come with optional wrapper frames. Use moreframes to include them or lessframes to omit them.
- Only used when inprop contains editintro.
- One of the following values: lessframes, moreframes
- Default: moreframes
- ineditintroskip
List of intro messages to remove from the response. Use this if a specific message is not relevant to your tool, or if the information is conveyed in a different way.
- Only used when inprop contains editintro.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ineditintrocustom
Title of a custom page to use as an additional intro message.
- Only used when inprop contains editintro.
- incontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get information about the page Main Page.
- api.php?action=query&prop=info&titles=Main%20Page [open in sandbox]
- Get general and protection information about the page Main Page.
- api.php?action=query&prop=info&inprop=protection&titles=Main%20Page [open in sandbox]
prop=iwlinks (iw)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all interwiki links from the given pages.
- iwprop
Which additional properties to get for each interwiki link:
- url
- Adds the full URL.
- Values (separate with | or alternative): url
- iwprefix
Only return interwiki links with this prefix.
- iwtitle
Interwiki link to search for. Must be used with iwprefix.
- iwdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- iwlimit
How many interwiki links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- iwcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iwurl
- Deprecated.
Whether to get the full URL (cannot be used with iwprop).
- Type: boolean (details)
- Get interwiki links from the page Main Page.
- api.php?action=query&prop=iwlinks&titles=Main%20Page [open in sandbox]
prop=langlinks (ll)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all interlanguage links from the given pages.
- llprop
Which additional properties to get for each interlanguage link:
- url
- Adds the full URL.
- langname
- Adds the localised language name (best effort). Use llinlanguagecode to control the language.
- autonym
- Adds the native language name.
- Values (separate with | or alternative): autonym, langname, url
- lllang
Only return language links with this language code.
- lltitle
Link to search for. Must be used with lllang.
- lldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- llinlanguagecode
Language code for localised language names.
- Default: en
- lllimit
How many langlinks to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- llcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- llurl
- Deprecated.
Whether to get the full URL (cannot be used with llprop).
- Type: boolean (details)
- Get interlanguage links from the page Main Page.
- api.php?action=query&prop=langlinks&titles=Main%20Page&redirects= [open in sandbox]
prop=links (pl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all links from the given pages.
- plnamespace
Show links in these namespaces only.
- Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- pllimit
How many links to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- plcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- pltitles
Only list links to these titles. Useful for checking whether a certain page links to a certain title.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get links from the page Main Page
- api.php?action=query&prop=links&titles=Main%20Page [open in sandbox]
- Get information about the link pages in the page Main Page.
- api.php?action=query&generator=links&titles=Main%20Page&prop=info [open in sandbox]
- Get links from the page Main Page in the User and Template namespaces.
- api.php?action=query&prop=links&titles=Main%20Page&plnamespace=2|10 [open in sandbox]
prop=linkshere (lh)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given pages.
- lhprop
Which properties to get:
- pageid
- Page ID of each page.
- title
- Title of each page.
- redirect
- Flag if the page is a redirect.
- Values (separate with | or alternative): pageid, redirect, title
- Default: pageid|title|redirect
- lhnamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- lhshow
Show only items that meet these criteria:
- redirect
- Only show redirects.
- !redirect
- Only show non-redirects.
- Values (separate with | or alternative): !redirect, redirect
- lhlimit
How many to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lhcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of pages linking to the Main Page.
- api.php?action=query&prop=linkshere&titles=Main%20Page [open in sandbox]
- Get information about pages linking to the Main Page.
- api.php?action=query&generator=linkshere&titles=Main%20Page&prop=info [open in sandbox]
prop=pageimages (pi)
- This module requires read rights.
- Source: PageImages
- License: WTFPL
Returns information about images on the page, such as thumbnail and presence of photos.
- piprop
Which information to return:
- thumbnail
- URL and dimensions of thumbnail image associated with page, if any.
- name
- Image title.
- original
- URL and original dimensions of image associated with page, if any.
- Values (separate with | or alternative): name, original, thumbnail
- Default: thumbnail|name
- pithumbsize
Maximum width in pixels of thumbnail images.
- Type: integer
- Default: 50
- pilimit
Properties of how many pages to return.
- Type: integer or max
- The value must be between 1 and 50.
- Default: 50
- pilicense
Limit page images to a certain license type:
- free
- Only free images.
- any
- Best image, whether free or non-free.
- One of the following values: any, free
- Default: free
- picontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- pilangcode
Code for the language the image is going to be rendered in if multiple languages are supported
- Get name and 100-pixel thumbnail of an image on the Albert Einstein page.
- api.php?action=query&prop=pageimages&titles=Albert%20Einstein&pithumbsize=100 [open in sandbox]
prop=pageprops (pp)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get various page properties defined in the page content.
- ppcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- ppprop
Only list these page properties (action=query&list=pagepropnames returns page property names in use). Useful for checking whether pages use a certain page property.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get properties for the pages Main Page and MediaWiki.
- api.php?action=query&prop=pageprops&titles=Main%20Page|MediaWiki [open in sandbox]
prop=pageterms (wbpt)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get the MonoCloud Wiki terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
- wbptcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- wbptlanguage
The language code to get terms in. If not specified, the user language is used.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uselang, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- Default: uselang
- wbptterms
The types of terms to get, e.g. 'description', each returned as an array of strings keyed by their type, e.g. {"description": ["foo"]}. If not specified, all types are returned.
- Values (separate with | or alternative): alias, description, label
- Default: alias|label|description
- Get all terms associated with the page 'London', in the user language.
- api.php?action=query&prop=pageterms&titles=London [open in sandbox]
- Get labels and aliases associated with the page 'London', in English.
- api.php?action=query&prop=pageterms&titles=London&wbptterms=label|alias&wbptlanguage=en [open in sandbox]
prop=redirects (rd)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all redirects to the given pages.
- rdprop
Which properties to get:
- pageid
- Page ID of each redirect.
- title
- Title of each redirect.
- fragment
- Fragment of each redirect, if any.
- Values (separate with | or alternative): fragment, pageid, title
- Default: pageid|title
- rdnamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- rdshow
Show only items that meet these criteria:
- fragment
- Only show redirects with a fragment.
- !fragment
- Only show redirects without a fragment.
- Values (separate with | or alternative): !fragment, fragment
- rdlimit
How many redirects to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- rdcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of redirects to the Main Page.
- api.php?action=query&prop=redirects&titles=Main%20Page [open in sandbox]
- Get information about all redirects to the Main Page.
- api.php?action=query&generator=redirects&titles=Main%20Page&prop=info [open in sandbox]
prop=revisions (rv)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get revision information.
May be used in several ways:
- Get data about a set of pages (last revision), by setting titles or pageids.
- Get revisions for one given page, by using titles or pageids with start, end, or limit.
- Get data about a set of revisions by setting their IDs with revids.
- rvprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, rvlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, rvlimit is enforced to 50.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- rvslots
Which revision slots to return data for, when slot-related properties are included in rvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- rvcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of rvslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- rvlimit
Limit how many revisions will be returned. If rvprop=content, rvprop=parsetree, rvdiffto or rvdifftotext is used, the limit is 50. If rvparse is used, the limit is 1.
- May only be used with a single page (mode #2).
- Type: integer or max
- The value must be between 1 and 500.
- rvexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires rvprop=content).
- Type: boolean (details)
- rvgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires rvprop=content).
- Type: boolean (details)
- rvparse
- Deprecated.
Use action=parse instead. Parse revision content (requires rvprop=content). For performance reasons, if this option is used, rvlimit is enforced to 1.
- Type: boolean (details)
- rvsection
Only retrieve the content of the section with this identifier.
- rvdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, rvlimit is enforced to 50.
- rvdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides rvdiffto. If rvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, rvlimit is enforced to 50.
- rvdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with rvdifftotext.
- Type: boolean (details)
- rvcontentformat
- Deprecated.
Serialization format used for rvdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- rvstartid
Start enumeration from the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.
- May only be used with a single page (mode #2).
- Type: integer
- rvendid
Stop enumeration at the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.
- May only be used with a single page (mode #2).
- Type: integer
- rvstart
From which revision timestamp to start enumeration.
- May only be used with a single page (mode #2).
- Type: timestamp (allowed formats)
- rvend
Enumerate up to this timestamp.
- May only be used with a single page (mode #2).
- Type: timestamp (allowed formats)
- rvdir
In which direction to enumerate:
- newer
- List oldest first. Note: rvstart has to be before rvend.
- older
- List newest first (default). Note: rvstart has to be later than rvend.
- May only be used with a single page (mode #2).
- One of the following values: newer, older
- Default: older
- rvuser
Only include revisions made by user.
- May only be used with a single page (mode #2).
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rvexcludeuser
Exclude revisions made by user.
- May only be used with a single page (mode #2).
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rvtag
Only list revisions tagged with this tag.
- rvcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get data with content for the last revision of titles API and Main Page.
- api.php?action=query&prop=revisions&titles=API|Main%20Page&rvslots=*&rvprop=timestamp|user|comment|content [open in sandbox]
- Get last 5 revisions of the Main Page.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment [open in sandbox]
- Get first 5 revisions of the Main Page.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvdir=newer [open in sandbox]
- Get first 5 revisions of the Main Page made after 2006-05-01.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvdir=newer&rvstart=2006-05-01T00:00:00Z [open in sandbox]
- Get first 5 revisions of the Main Page that were not made by anonymous user 127.0.0.1.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvexcludeuser=127.0.0.1 [open in sandbox]
- Get first 5 revisions of the Main Page that were made by the user MediaWiki default.
- api.php?action=query&prop=revisions&titles=Main%20Page&rvlimit=5&rvprop=timestamp|user|comment&rvuser=MediaWiki%20default [open in sandbox]
prop=stashimageinfo (sii)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns file information for stashed files.
- siifilekey
Key that identifies a previous upload that was stashed temporarily.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- siisessionkey
- Deprecated.
Alias for siifilekey, for backward compatibility.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- siiprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- thumbmime
- Adds MIME type of the image thumbnail (requires url and param siiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, commonmetadata, dimensions, extmetadata, metadata, mime, sha1, size, thumbmime, timestamp, url
- Default: timestamp|url
- siiurlwidth
If siiprop=url is set, a URL to an image scaled to this width will be returned. For performance reasons if this option is used, no more than 50 scaled images will be returned.
- Type: integer
- Default: -1
- siiurlheight
Similar to siiurlwidth.
- Type: integer
- Default: -1
- siiurlparam
A handler specific parameter string. For example, PDFs might use page15-100px. siiurlwidth must be used and be consistent with siiurlparam.
- Default: (empty)
- Returns information for a stashed file.
- api.php?action=query&prop=stashimageinfo&siifilekey=124sd34rsdf567 [open in sandbox]
- Returns thumbnails for two stashed files.
- api.php?action=query&prop=stashimageinfo&siifilekey=b34edoe3|bceffd4&siiurlwidth=120&siiprop=url [open in sandbox]
prop=templates (tl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Returns all pages transcluded on the given pages.
- tlnamespace
Show templates in these namespaces only.
- Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- tllimit
How many templates to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- tlcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- tltemplates
Only list these templates. Useful for checking whether a certain page uses a certain template.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- tldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get the templates used on the page Main Page.
- api.php?action=query&prop=templates&titles=Main%20Page [open in sandbox]
- Get information about the template pages used on the page Main Page.
- api.php?action=query&generator=templates&titles=Main%20Page&prop=info [open in sandbox]
- Get pages in the User and Template namespaces that are transcluded on the page Main Page.
- api.php?action=query&prop=templates&titles=Main%20Page&tlnamespace=2|10 [open in sandbox]
prop=transcludedin (ti)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that transclude the given pages.
- tiprop
Which properties to get:
- pageid
- Page ID of each page.
- title
- Title of each page.
- redirect
- Flag if the page is a redirect.
- Values (separate with | or alternative): pageid, redirect, title
- Default: pageid|title|redirect
- tinamespace
Only include pages in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- tishow
Show only items that meet these criteria:
- redirect
- Only show redirects.
- !redirect
- Only show non-redirects.
- Values (separate with | or alternative): !redirect, redirect
- tilimit
How many to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ticontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get a list of pages transcluding Main Page.
- api.php?action=query&prop=transcludedin&titles=Main%20Page [open in sandbox]
- Get information about pages transcluding Main Page.
- api.php?action=query&generator=transcludedin&titles=Main%20Page&prop=info [open in sandbox]
prop=wbentityusage (wbeu)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Returns all entity IDs used in the given pages.
- wbeuprop
Properties to add to the result.
- url
- If enabled url of entity will be added
- Values (separate with | or alternative): url
- wbeuaspect
Only return entity IDs that used this aspect.
- S
- The entity's sitelinks are used
- L
- The entity's label is used
- D
- The entity's description is used
- T
- The title of the local page corresponding to the entity is used
- C
- Statements from the entity are used
- X
- All aspects of an entity are or may be used
- O
- Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
- Values (separate with | or alternative): C, D, L, O, S, T, X
- wbeuentities
Only return page that used these entities.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wbeulimit
How many entity usages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wbeucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get entities used in the page Main Page.
- api.php?action=query&prop=wbentityusage&titles=Main%20Page [open in sandbox]
list=abusefilters (abf)
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Show details of the abuse filters.
- abfstartid
The filter ID to start enumerating from.
- Type: integer
- abfendid
The filter ID to stop enumerating at.
- Type: integer
- abfdir
In which direction to enumerate:
- One of the following values: newer, older
- Default: newer
- abfshow
Show only filters which meet these criteria.
- Values (separate with | or alternative): !deleted, !enabled, !private, !protected, deleted, enabled, private, protected
- abflimit
The maximum number of filters to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- abfprop
Which properties to get.
- Values (separate with | or alternative): actions, comments, description, hits, id, lasteditor, lastedittime, pattern, private, protected, status
- Default: id|description|actions|status
- List enabled public filters
- api.php?action=query&list=abusefilters&abfshow=enabled|!private [open in sandbox]
- Show some details about filters
- api.php?action=query&list=abusefilters&abfprop=id|description|pattern [open in sandbox]
list=abuselog (afl)
- This module requires read rights.
- Source: Abuse Filter
- License: GPL-2.0-or-later
Show events that were caught by one of the abuse filters.
- afllogid
Show an entry with the given log ID.
- Type: integer
- aflstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- aflend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- afldir
In which direction to enumerate:
- One of the following values: newer, older
- Default: older
- afluser
Show only entries done by a given user or IP address.
- afltitle
Show only entries occurring on a given page.
- aflfilter
Show only entries that were caught by the given filter IDs. Separate with pipes, prefix with "global-" for global filters.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- afllimit
The maximum amount of entries to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- aflprop
Which properties to get.
- Values (separate with | or alternative): action, details, filter, hidden, ids, result, revid, timestamp, title, user
- Default: ids|user|title|action|result|timestamp|hidden|revid
- Show recent log entries
- api.php?action=query&list=abuselog [open in sandbox]
- Show recent log entries for API
- api.php?action=query&list=abuselog&afltitle=API [open in sandbox]
list=allcategories (ac)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all categories.
- acfrom
The category to start enumerating from.
- accontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- acto
The category to stop enumerating at.
- acprefix
Search for all category titles that begin with this value.
- acdir
Direction to sort in.
- One of the following values: ascending, descending
- Default: ascending
- acmin
Only return categories with at least this many members.
- Type: integer
- acmax
Only return categories with at most this many members.
- Type: integer
- aclimit
How many categories to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- acprop
Which properties to get:
- size
- Adds number of pages in the category.
- hidden
- Tags categories that are hidden with
__HIDDENCAT__.
- Values (separate with | or alternative): hidden, size
- Default: (empty)
- List categories with information on the number of pages in each.
- api.php?action=query&list=allcategories&acprop=size [open in sandbox]
- Retrieve info about the category page itself for categories beginning List.
- api.php?action=query&generator=allcategories&gacprefix=List&prop=info [open in sandbox]
list=alldeletedrevisions (adr)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all deleted revisions by a user or in a namespace.
- adrprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, adrlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, adrlimit is enforced to 50.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- adrslots
Which revision slots to return data for, when slot-related properties are included in adrprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- adrcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of adrslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- adrlimit
Limit how many revisions will be returned. If adrprop=content, adrprop=parsetree, adrdiffto or adrdifftotext is used, the limit is 50. If adrparse is used, the limit is 1.
- Type: integer or max
- The value must be between 1 and 500.
- adrexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires adrprop=content).
- Type: boolean (details)
- adrgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires adrprop=content).
- Type: boolean (details)
- adrparse
- Deprecated.
Use action=parse instead. Parse revision content (requires adrprop=content). For performance reasons, if this option is used, adrlimit is enforced to 1.
- Type: boolean (details)
- adrsection
Only retrieve the content of the section with this identifier.
- adrdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, adrlimit is enforced to 50.
- adrdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides adrdiffto. If adrsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, adrlimit is enforced to 50.
- adrdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with adrdifftotext.
- Type: boolean (details)
- adrcontentformat
- Deprecated.
Serialization format used for adrdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- adruser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- adrnamespace
Only list pages in this namespace.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- adrstart
The timestamp to start enumerating from.
- May only be used with adruser.
- Type: timestamp (allowed formats)
- adrend
The timestamp to stop enumerating at.
- May only be used with adruser.
- Type: timestamp (allowed formats)
- adrdir
In which direction to enumerate:
- newer
- List oldest first. Note: adrstart has to be before adrend.
- older
- List newest first (default). Note: adrstart has to be later than adrend.
- One of the following values: newer, older
- Default: older
- adrfrom
Start listing at this title.
- Cannot be used with adruser.
- adrto
Stop listing at this title.
- Cannot be used with adruser.
- adrprefix
Search for all page titles that begin with this value.
- Cannot be used with adruser.
- adrexcludeuser
Don't list revisions by this user.
- Cannot be used with adruser.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- adrtag
Only list revisions tagged with this tag.
- adrcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- adrgeneratetitles
When being used as a generator, generate titles rather than revision IDs.
- Type: boolean (details)
- List the last 50 deleted contributions by user Example.
- api.php?action=query&list=alldeletedrevisions&adruser=Example&adrlimit=50 [open in sandbox]
- List the first 50 deleted revisions in the main namespace.
- api.php?action=query&list=alldeletedrevisions&adrdir=newer&adrnamespace=0&adrlimit=50 [open in sandbox]
list=allfileusages (af)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all file usages, including non-existing.
- afcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- affrom
The title of the file to start enumerating from.
- afto
The title of the file to stop enumerating at.
- afprefix
Search for all file titles that begin with this value.
- afunique
Only show distinct file titles. Cannot be used with afprop=ids. When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- afprop
Which pieces of information to include:
- ids
- Adds the page IDs of the using pages (cannot be used with afunique).
- title
- Adds the title of the file.
- Values (separate with | or alternative): ids, title
- Default: title
- aflimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- afdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List file titles, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=allfileusages&affrom=B&afprop=ids|title [open in sandbox]
- List unique file titles.
- api.php?action=query&list=allfileusages&afunique=&affrom=B [open in sandbox]
- Gets all file titles, marking the missing ones.
- api.php?action=query&generator=allfileusages&gafunique=&gaffrom=B [open in sandbox]
- Gets pages containing the files.
- api.php?action=query&generator=allfileusages&gaffrom=B [open in sandbox]
list=allimages (ai)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all images sequentially.
- aisort
Property to sort by.
- One of the following values: name, timestamp
- Default: name
- aidir
The direction in which to list.
- One of the following values: ascending, descending, newer, older
- Default: ascending
- aifrom
The image title to start enumerating from. Can only be used with aisort=name.
- aito
The image title to stop enumerating at. Can only be used with aisort=name.
- aicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- aistart
The timestamp to start enumerating from. Can only be used with aisort=timestamp.
- Type: timestamp (allowed formats)
- aiend
The timestamp to end enumerating. Can only be used with aisort=timestamp.
- Type: timestamp (allowed formats)
- aiprop
Which file information to get:
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
- canonicaltitle
- Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
- url
- Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
- size
- Adds the size of the file in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- sha1
- Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
- mime
- Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
- mediatype
- Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
- metadata
- Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- commonmetadata
- Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
- extmetadata
- Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.
Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.
- bitdepth
- Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
- badfile
- Adds whether the file is on the MediaWiki:Bad image list
- Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, timestamp, url, user, userid
- Default: timestamp|url
- aiprefix
Search for all image titles that begin with this value. Can only be used with aisort=name.
- aiminsize
Limit to images with at least this many bytes.
- Type: integer
- aimaxsize
Limit to images with at most this many bytes.
- Type: integer
- aisha1
SHA1 hash of image. Overrides aisha1base36.
- aisha1base36
SHA1 hash of image in base 36 (used in MediaWiki).
- aiuser
Only return files where the last version was uploaded by this user. Can only be used with aisort=timestamp. Cannot be used together with aifilterbots.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- aifilterbots
How to filter files uploaded by bots. Can only be used with aisort=timestamp. Cannot be used together with aiuser.
- One of the following values: all, bots, nobots
- Default: all
- aimime
What MIME types to search for, e.g. image/jpeg.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ailimit
How many images in total to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Show a list of files starting at the letter B.
- api.php?action=query&list=allimages&aifrom=B [open in sandbox]
- Show a list of recently uploaded files, similar to Special:NewFiles.
- api.php?action=query&list=allimages&aiprop=user|timestamp|url&aisort=timestamp&aidir=older [open in sandbox]
- Show a list of files with MIME type image/png or image/gif
- api.php?action=query&list=allimages&aimime=image/png|image/gif [open in sandbox]
- Show info about 4 files starting at the letter T.
- api.php?action=query&generator=allimages&gailimit=4&gaifrom=T&prop=imageinfo [open in sandbox]
list=alllinks (al)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all links that point to a given namespace.
- alcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- alfrom
The title of the link to start enumerating from.
- alto
The title of the link to stop enumerating at.
- alprefix
Search for all linked titles that begin with this value.
- alunique
Only show distinct linked titles. Cannot be used with alprop=ids. When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- alprop
Which pieces of information to include:
- ids
- Adds the page ID of the linking page (cannot be used with alunique).
- title
- Adds the title of the link.
- Values (separate with | or alternative): ids, title
- Default: title
- alnamespace
The namespace to enumerate.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- Default: 0
- allimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- aldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List linked titles, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=alllinks&alfrom=B&alprop=ids|title [open in sandbox]
- List unique linked titles.
- api.php?action=query&list=alllinks&alunique=&alfrom=B [open in sandbox]
- Gets all linked titles, marking the missing ones.
- api.php?action=query&generator=alllinks&galunique=&galfrom=B [open in sandbox]
- Gets pages containing the links.
- api.php?action=query&generator=alllinks&galfrom=B [open in sandbox]
list=allpages (ap)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all pages sequentially in a given namespace.
- apfrom
The page title to start enumerating from.
- apcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- apto
The page title to stop enumerating at.
- apprefix
Search for all page titles that begin with this value.
- apnamespace
The namespace to enumerate.
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- Default: 0
- apfilterredir
Which pages to list.
- One of the following values: all, nonredirects, redirects
- Default: all
- apfilterlanglinks
Filter based on whether a page has langlinks. Note that this may not consider langlinks added by extensions.
- One of the following values: all, withlanglinks, withoutlanglinks
- Default: all
- apminsize
Limit to pages with at least this many bytes.
- Type: integer
- apmaxsize
Limit to pages with at most this many bytes.
- Type: integer
- apprtype
Limit to protected pages only.
- Values (separate with | or alternative): edit, move, upload
- apprlevel
Filter protections based on protection level (must be used with apprtype= parameter).
- Values (separate with | or alternative): Can be empty, or autoconfirmed, sysop
- apprfiltercascade
Filter protections based on cascadingness (ignored when apprtype isn't set).
- One of the following values: all, cascading, noncascading
- Default: all
- apprexpiry
Which protection expiry to filter the page on:
- indefinite
- Get only pages with indefinite protection expiry.
- definite
- Get only pages with a definite (specific) protection expiry.
- all
- Get pages with any protections expiry.
- One of the following values: all, definite, indefinite
- Default: all
- aplimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- apdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Show a list of pages starting at the letter B.
- api.php?action=query&list=allpages&apfrom=B [open in sandbox]
- Show info about 4 pages starting at the letter T.
- api.php?action=query&generator=allpages&gaplimit=4&gapfrom=T&prop=info [open in sandbox]
- Show content of first 2 non-redirect pages beginning at Re.
- api.php?action=query&generator=allpages&gaplimit=2&gapfilterredir=nonredirects&gapfrom=Re&prop=revisions&rvprop=content [open in sandbox]
list=allredirects (ar)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all redirects to a namespace.
- arcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- arfrom
The title of the redirect to start enumerating from.
- arto
The title of the redirect to stop enumerating at.
- arprefix
Search for all target pages that begin with this value.
- arunique
Only show distinct target pages. Cannot be used with arprop=ids|fragment|interwiki. When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- arprop
Which pieces of information to include:
- ids
- Adds the page ID of the redirecting page (cannot be used with arunique).
- title
- Adds the title of the redirect.
- fragment
- Adds the fragment from the redirect, if any (cannot be used with arunique).
- interwiki
- Adds the interwiki prefix from the redirect, if any (cannot be used with arunique).
- Values (separate with | or alternative): fragment, ids, interwiki, title
- Default: title
- arnamespace
The namespace to enumerate.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- Default: 0
- arlimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ardir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List target pages, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=allredirects&arfrom=B&arprop=ids|title [open in sandbox]
- List unique target pages.
- api.php?action=query&list=allredirects&arunique=&arfrom=B [open in sandbox]
- Gets all target pages, marking the missing ones.
- api.php?action=query&generator=allredirects&garunique=&garfrom=B [open in sandbox]
- Gets pages containing the redirects.
- api.php?action=query&generator=allredirects&garfrom=B [open in sandbox]
list=allrevisions (arv)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all revisions.
- arvprop
Which properties to get for each revision:
- ids
- The ID of the revision.
- flags
- Revision flags (minor).
- timestamp
- The timestamp of the revision.
- user
- User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
- userid
- User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
- size
- Length (bytes) of the revision.
- slotsize
- Length (bytes) of each revision slot.
- sha1
- SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
- slotsha1
- SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
- contentmodel
- Content model ID of each revision slot.
- comment
- Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
- content
- Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, arvlimit is enforced to 50.
- tags
- Tags for the revision.
- roles
- List content slot roles that exist in the revision.
- parsetree
- Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model
wikitext). For performance reasons, if this option is used, arvlimit is enforced to 50.
- Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
- Default: ids|timestamp|flags|comment|user
- arvslots
Which revision slots to return data for, when slot-related properties are included in arvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.
- Values (separate with | or alternative): main
- To specify all values, use *.
- arvcontentformat-{slot}
Content serialization format used for output of content.
- This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of arvslots.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- arvlimit
Limit how many revisions will be returned. If arvprop=content, arvprop=parsetree, arvdiffto or arvdifftotext is used, the limit is 50. If arvparse is used, the limit is 1.
- Type: integer or max
- The value must be between 1 and 500.
- arvexpandtemplates
- Deprecated.
Use action=expandtemplates instead. Expand templates in revision content (requires arvprop=content).
- Type: boolean (details)
- arvgeneratexml
- Deprecated.
Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires arvprop=content).
- Type: boolean (details)
- arvparse
- Deprecated.
Use action=parse instead. Parse revision content (requires arvprop=content). For performance reasons, if this option is used, arvlimit is enforced to 1.
- Type: boolean (details)
- arvsection
Only retrieve the content of the section with this identifier.
- arvdiffto
- Deprecated.
Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, arvlimit is enforced to 50.
- arvdifftotext
- Deprecated.
Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides arvdiffto. If arvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, arvlimit is enforced to 50.
- arvdifftotextpst
- Deprecated.
Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with arvdifftotext.
- Type: boolean (details)
- arvcontentformat
- Deprecated.
Serialization format used for arvdifftotext and expected for output of content.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- arvuser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- arvnamespace
Only list pages in this namespace.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- arvstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- arvend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- arvdir
In which direction to enumerate:
- newer
- List oldest first. Note: arvstart has to be before arvend.
- older
- List newest first (default). Note: arvstart has to be later than arvend.
- One of the following values: newer, older
- Default: older
- arvexcludeuser
Don't list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- arvcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- arvgeneratetitles
When being used as a generator, generate titles rather than revision IDs.
- Type: boolean (details)
- List the last 50 contributions by user Example.
- api.php?action=query&list=allrevisions&arvuser=Example&arvlimit=50 [open in sandbox]
- List the first 50 revisions in any namespace.
- api.php?action=query&list=allrevisions&arvdir=newer&arvlimit=50 [open in sandbox]
list=alltransclusions (at)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all transclusions (pages embedded using {{x}}), including non-existing.
- atcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- atfrom
The title of the transclusion to start enumerating from.
- atto
The title of the transclusion to stop enumerating at.
- atprefix
Search for all transcluded titles that begin with this value.
- atunique
Only show distinct transcluded titles. Cannot be used with atprop=ids. When used as a generator, yields target pages instead of source pages.
- Type: boolean (details)
- atprop
Which pieces of information to include:
- ids
- Adds the page ID of the transcluding page (cannot be used with atunique).
- title
- Adds the title of the transclusion.
- Values (separate with | or alternative): ids, title
- Default: title
- atnamespace
The namespace to enumerate.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- Default: 10
- atlimit
How many total items to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- atdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- List transcluded titles, including missing ones, with page IDs they are from, starting at B.
- api.php?action=query&list=alltransclusions&atfrom=B&atprop=ids|title [open in sandbox]
- List unique transcluded titles.
- api.php?action=query&list=alltransclusions&atunique=&atfrom=B [open in sandbox]
- Gets all transcluded titles, marking the missing ones.
- api.php?action=query&generator=alltransclusions&gatunique=&gatfrom=B [open in sandbox]
- Gets pages containing the transclusions.
- api.php?action=query&generator=alltransclusions&gatfrom=B [open in sandbox]
list=allusers (au)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all registered users.
- aufrom
The username to start enumerating from.
- auto
The username to stop enumerating at.
- auprefix
Search for all users that begin with this value.
- audir
Direction to sort in.
- One of the following values: ascending, descending
- Default: ascending
- augroup
Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
- auexcludegroup
Exclude users in the given groups.
- Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
- aurights
Only include users with the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.
- Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, badcaptcha, badoath, bigdelete, block, blockemail, bot, browsearchive, changeemail, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, checkuser-userinfo, confirmemail, createaccount, createpage, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, disableoath, echo-create, echo-read-notifications, edit, editcontentmodel, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, editusercss, edituserjs, edituserjson, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-ip-lookup, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, item-merge, item-redirect, item-term, linkpurge, logentryimport, mailpassword, manage-all-push-subscriptions, managechangetags, markbotedits, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, patrol, patrolmarks, property-create, property-term, protect, purge, read, recover-2fa, renameuser, renameuser-global, renderfile, renderfile-nonstandard, replacetext, reupload, reupload-own, reupload-shared, rollback, sboverride, sendemail, siteadmin, skipcaptcha, spamblacklistlog, stashbasehtml, stashedit, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, thanks-notification, titleblacklistlog, unblockself, undelete, unwatchedpages, upload, upload_by_url, userrights, userrights-interwiki, verify-2fa, viewmyprivateinfo, viewmywatchlist, viewsuppressed, wikibase-idgenerator, wikimediaevents-hcaptcha-diff-logging
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- auprop
Which pieces of information to include:
- blockinfo
- Adds the information about a current block on the user.
- groups
- Lists groups that the user is in. This uses more server resources and may return fewer results than the limit.
- implicitgroups
- Lists all the groups the user is automatically in.
- rights
- Lists rights that the user has.
- editcount
- Adds the edit count of the user.
- registration
- Adds the timestamp of when the user registered if available (may be blank).
- centralids
- Adds the central IDs and attachment status for the user.
- tempexpired
- Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
- Values (separate with | or alternative): blockinfo, centralids, editcount, groups, implicitgroups, registration, rights, tempexpired
- aulimit
How many total usernames to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- auwitheditsonly
Only list users who have made edits.
- Type: boolean (details)
- auactiveusers
Only list users active in the last 30 days.
- Type: boolean (details)
- auattachedwiki
With auprop=centralids, also indicate whether the user is attached with the wiki identified by this ID.
- auexcludenamed
Exclude users of named accounts.
- Type: boolean (details)
- auexcludetemp
Exclude users of temporary accounts.
- Type: boolean (details)
- List users starting at Y.
- api.php?action=query&list=allusers&aufrom=Y [open in sandbox]
list=backlinks (bl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given page.
- bltitle
Title to search. Cannot be used together with blpageid.
- blpageid
Page ID to search. Cannot be used together with bltitle.
- Type: integer
- blcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- blnamespace
The namespace to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- bldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- blfilterredir
How to filter for redirects. If set to nonredirects when blredirect is enabled, this is only applied to the second level.
- One of the following values: all, nonredirects, redirects
- Default: all
- bllimit
How many total pages to return. If blredirect is enabled, the limit applies to each level separately (which means up to 2 * bllimit results may be returned).
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- blredirect
If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.
- Type: boolean (details)
- Show links to Main Page.
- api.php?action=query&list=backlinks&bltitle=Main%20Page [open in sandbox]
- Get information about pages linking to Main Page.
- api.php?action=query&generator=backlinks&gbltitle=Main%20Page&prop=info [open in sandbox]
list=blocks (bk)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all blocked users and IP addresses.
- bkstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- bkend
The timestamp to stop enumerating at.
- Type: timestamp (allowed formats)
- bkdir
In which direction to enumerate:
- newer
- List oldest first. Note: bkstart has to be before bkend.
- older
- List newest first (default). Note: bkstart has to be later than bkend.
- One of the following values: newer, older
- Default: older
- bkids
List of block IDs to list (optional).
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bkusers
List of users to search for (optional).
- Type: list of users, by any of username, IP, Temporary user and IP range
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- bkip
Get all blocks applying to this IP address or CIDR range, including range blocks. Cannot be used together with bkusers. CIDR ranges broader than IPv4/16 or IPv6/19 are not accepted.
- bklimit
The maximum number of blocks to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- bkprop
Which properties to get:
- id
- Adds the ID of the block.
- user
- Adds the username of the blocked user.
- userid
- Adds the user ID of the blocked user.
- by
- Adds the username of the blocking user.
- byid
- Adds the user ID of the blocking user.
- timestamp
- Adds the timestamp of when the block was given.
- expiry
- Adds the timestamp of when the block expires.
- reason
- Adds the reason given for the block.
- parsedreason
- Adds the parsed reason given for the block.
- range
- Adds the range of IP addresses affected by the block.
- flags
- Tags the ban with (autoblock, anononly, etc.).
- restrictions
- Adds the partial block restrictions if the block is not sitewide.
- Values (separate with | or alternative): by, byid, expiry, flags, id, parsedreason, range, reason, restrictions, timestamp, user, userid
- Default: id|user|by|timestamp|expiry|reason|flags
- bkshow
Show only items that meet these criteria. For example, to see only indefinite blocks on IP addresses, set bkshow=ip|!temp.
- Values (separate with | or alternative): !account, !ip, !range, !temp, account, ip, range, temp
- bkcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List blocks.
- api.php?action=query&list=blocks [open in sandbox]
- List blocks of users Alice and Bob.
- api.php?action=query&list=blocks&bkusers=Alice|Bob [open in sandbox]
list=categorymembers (cm)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all pages in a given category.
- cmtitle
Which category to enumerate (required). Must include the Category: prefix. Cannot be used together with cmpageid.
- cmpageid
Page ID of the category to enumerate. Cannot be used together with cmtitle.
- Type: integer
- cmprop
Which pieces of information to include:
- ids
- Adds the page ID.
- title
- Adds the title and namespace ID of the page.
- sortkey
- Adds the sortkey used for sorting in the category (hexadecimal string).
- sortkeyprefix
- Adds the sortkey prefix used for sorting in the category (human-readable part of the sortkey).
- type
- Adds the type that the page has been categorised as (page, subcat or file).
- timestamp
- Adds the timestamp of when the page was included.
- Values (separate with | or alternative): ids, sortkey, sortkeyprefix, timestamp, title, type
- Default: ids|title
- cmnamespace
Only include pages in these namespaces. Note that cmtype=subcat or cmtype=file may be used instead of cmnamespace=14 or 6.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- cmtype
Which type of category members to include. Ignored when cmsort=timestamp is set.
- Values (separate with | or alternative): file, page, subcat
- Default: page|subcat|file
- cmcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- cmlimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- cmsort
Property to sort by.
- One of the following values: sortkey, timestamp
- Default: sortkey
- cmdir
In which direction to sort.
- One of the following values: asc, ascending, desc, descending, newer, older
- Default: ascending
- cmstart
Timestamp to start listing from. Can only be used with cmsort=timestamp.
- Type: timestamp (allowed formats)
- cmend
Timestamp to end listing at. Can only be used with cmsort=timestamp.
- Type: timestamp (allowed formats)
- cmstarthexsortkey
Sortkey to start listing from, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.
- cmendhexsortkey
Sortkey to end listing at, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.
- cmstartsortkeyprefix
Sortkey prefix to start listing from. Can only be used with cmsort=sortkey. Overrides cmstarthexsortkey.
- cmendsortkeyprefix
Sortkey prefix to end listing before (not at; if this value occurs it will not be included!). Can only be used with cmsort=sortkey. Overrides cmendhexsortkey.
- cmstartsortkey
- Deprecated.
Use cmstarthexsortkey instead.
- cmendsortkey
- Deprecated.
Use cmendhexsortkey instead.
- Get first 10 pages in Category:Physics.
- api.php?action=query&list=categorymembers&cmtitle=Category:Physics [open in sandbox]
- Get page info about first 10 pages in Category:Physics.
- api.php?action=query&generator=categorymembers&gcmtitle=Category:Physics&prop=info [open in sandbox]
list=checkuser (cu)
- This module is deprecated.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: CheckUser
- License: GPL-2.0-or-later
This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
- curequest
Type of CheckUser request:
- userips
- Get IP address of target user.
- edits
- Deprecated. Get actions performed by target IP address or range.
- actions
- Get actions performed by target IP address or range.
- ipusers
- Get users from target IP address or range.
- This parameter is required.
- One of the following values: actions, ipusers, userips, edits
- cutarget
Username, IP address, or CIDR range to check.
- This parameter is required.
- Type: user, by any of username, IP, Temporary user and IP range
- cureason
Reason to check.
- This parameter is required.
- Default: (empty)
- culimit
Limit of rows.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 500
- cutimecond
Time limit of user data (like "-2 weeks" or "2 weeks ago").
- Default: -2 weeks
- cuxff
Use XFF data instead of IP address.
- cutoken
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Get IP addresses for User:Example
- api.php?action=query&list=checkuser&curequest=userips&cutarget=Jimbo_Wales [open in sandbox]
- Get actions performed by 192.0.2.0/24
- api.php?action=query&list=checkuser&curequest=actions&cutarget=127.0.0.1/16&xff=1&cureason=Some_check [open in sandbox]
list=checkuserlog (cul)
- This module requires read rights.
- Source: CheckUser
- License: GPL-2.0-or-later
Get entries from the CheckUser log.
- culuser
Username of the CheckUser.
- cultarget
Checked user, IP address, or CIDR range.
- culreason
Reason given for the check.
- cullimit
Limit of rows.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- culdir
In which direction to enumerate:
- newer
- List oldest first. Note: culfrom has to be before culto.
- older
- List newest first (default). Note: culfrom has to be later than culto.
- One of the following values: newer, older
- Default: older
- culfrom
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- culto
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- culcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show checks of User:Example
- api.php?action=query&list=checkuserlog&culuser=Example&cullimit=25 [open in sandbox]
- Show checks of 192.0.2.0/24 after 2011-10-15T23:00:00Z
- api.php?action=query&list=checkuserlog&cultarget=192.0.2.0/24&culfrom=2011-10-15T23:00:00Z [open in sandbox]
list=codexicons
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get Codex icons
- names
Names of icons
- This parameter is required.
- Values (separate with | or alternative): cdxIconAdd, cdxIconAlert, cdxIconAlignCenter, cdxIconAlignLeft, cdxIconAlignRight, cdxIconAppearance, cdxIconArrowDown, cdxIconArrowNext, cdxIconArrowPrevious, cdxIconArrowUp, cdxIconArticle, cdxIconArticleAdd, cdxIconArticleCheck, cdxIconArticleDisambiguation, cdxIconArticleNotFound, cdxIconArticleRedirect, cdxIconArticleSearch, cdxIconArticles, cdxIconArticlesSearch, cdxIconAttachment, cdxIconBell, cdxIconBellOutline, cdxIconBigger, cdxIconBlock, cdxIconBold, cdxIconBook, cdxIconBookmark, cdxIconBookmarkList, cdxIconBookmarkOutline, cdxIconBright, cdxIconBrowser, cdxIconCalendar, cdxIconCamera, cdxIconCancel, cdxIconChart, cdxIconCheck, cdxIconCheckAll, cdxIconClear, cdxIconClock, cdxIconClose, cdxIconCode, cdxIconCollapse, cdxIconConfigure, cdxIconCopy, cdxIconCut, cdxIconDatabase, cdxIconDie, cdxIconDoubleChevronEnd, cdxIconDoubleChevronStart, cdxIconDownTriangle, cdxIconDownload, cdxIconDraggable, cdxIconEdit, cdxIconEditLock, cdxIconEditUndo, cdxIconEllipsis, cdxIconError, cdxIconExitFullscreen, cdxIconExpand, cdxIconEye, cdxIconEyeClosed, cdxIconFeedback, cdxIconFlag, cdxIconFolderPlaceholder, cdxIconFullscreen, cdxIconFunction, cdxIconFunctionArgument, cdxIconFunnel, cdxIconGlobe, cdxIconHalfBright, cdxIconHalfStar, cdxIconHand, cdxIconHeart, cdxIconHelp, cdxIconHelpNotice, cdxIconHieroglyph, cdxIconHighlight, cdxIconHistory, cdxIconHome, cdxIconImage, cdxIconImageAdd, cdxIconImageBroken, cdxIconImageGallery, cdxIconImageLayoutBasic, cdxIconImageLayoutFrame, cdxIconImageLayoutFrameless, cdxIconImageLayoutThumbnail, cdxIconImageLock, cdxIconIndent, cdxIconInfo, cdxIconInfoFilled, cdxIconInstance, cdxIconItalic, cdxIconJournal, cdxIconKey, cdxIconKeyboard, cdxIconLabFlask, cdxIconLanguage, cdxIconLargerText, cdxIconLayout, cdxIconLightbulb, cdxIconLink, cdxIconLinkExternal, cdxIconLinkSecure, cdxIconListBullet, cdxIconListNumbered, cdxIconLiteral, cdxIconLock, cdxIconLogIn, cdxIconLogOut, cdxIconLogoCC, cdxIconLogoCodex, cdxIconLogoMediaWiki, cdxIconLogoMetaWiki, cdxIconLogoWikibooks, cdxIconLogoWikidata, cdxIconLogoWikifunctions, cdxIconLogoWikimedia, cdxIconLogoWikimediaCommons, cdxIconLogoWikimediaDiscovery, cdxIconLogoWikinews, cdxIconLogoWikipedia, cdxIconLogoWikiquote, cdxIconLogoWikisource, cdxIconLogoWikispecies, cdxIconLogoWikiversity, cdxIconLogoWikivoyage, cdxIconLogoWiktionary, cdxIconMap, cdxIconMapPin, cdxIconMapPinAdd, cdxIconMapTrail, cdxIconMarkup, cdxIconMathematics, cdxIconMathematicsDisplayBlock, cdxIconMathematicsDisplayDefault, cdxIconMathematicsDisplayInline, cdxIconMenu, cdxIconMerge, cdxIconMessage, cdxIconMoon, cdxIconMove, cdxIconMoveFirst, cdxIconMoveLast, cdxIconMusicalScore, cdxIconNetwork, cdxIconNetworkOff, cdxIconNewWindow, cdxIconNewline, cdxIconNewspaper, cdxIconNext, cdxIconNoWikitext, cdxIconNotBright, cdxIconNotice, cdxIconOngoingConversation, cdxIconOutdent, cdxIconOutline, cdxIconPageSettings, cdxIconPalette, cdxIconPaste, cdxIconPause, cdxIconPlay, cdxIconPower, cdxIconPrevious, cdxIconPrinter, cdxIconPushPin, cdxIconPuzzle, cdxIconQrCode, cdxIconQuotes, cdxIconRecentChanges, cdxIconRedo, cdxIconReference, cdxIconReferenceExisting, cdxIconReferences, cdxIconReload, cdxIconRestore, cdxIconRobot, cdxIconSandbox, cdxIconSearch, cdxIconSearchCaseSensitive, cdxIconSearchDiacritics, cdxIconSearchRegularExpression, cdxIconSettings, cdxIconShare, cdxIconSignature, cdxIconSmaller, cdxIconSmallerText, cdxIconSortVertical, cdxIconSpecialCharacter, cdxIconSpecialPages, cdxIconSpeechBubble, cdxIconSpeechBubbleAdd, cdxIconSpeechBubbles, cdxIconStar, cdxIconStop, cdxIconStrikethrough, cdxIconSubscript, cdxIconSubtract, cdxIconSuccess, cdxIconSuperscript, cdxIconTable, cdxIconTableAddColumnAfter, cdxIconTableAddColumnBefore, cdxIconTableAddRowAfter, cdxIconTableAddRowBefore, cdxIconTableCaption, cdxIconTableMergeCells, cdxIconTableMoveColumnAfter, cdxIconTableMoveColumnBefore, cdxIconTableMoveRowAfter, cdxIconTableMoveRowBefore, cdxIconTag, cdxIconTemplateAdd, cdxIconTextDirLTR, cdxIconTextDirRTL, cdxIconTextFlow, cdxIconTextStyle, cdxIconTextSummary, cdxIconTrash, cdxIconTray, cdxIconUnBlock, cdxIconUnFlag, cdxIconUnLink, cdxIconUnLock, cdxIconUnStar, cdxIconUnderline, cdxIconUndo, cdxIconUpTriangle, cdxIconUpdate, cdxIconUpload, cdxIconUserActive, cdxIconUserAdd, cdxIconUserAnonymous, cdxIconUserAvatar, cdxIconUserAvatarOutline, cdxIconUserBlocked, cdxIconUserContributions, cdxIconUserGroup, cdxIconUserRights, cdxIconUserTalk, cdxIconUserTemporary, cdxIconUserTemporaryLocation, cdxIconViewCompact, cdxIconViewDetails, cdxIconVisionSimulator, cdxIconVolumeDown, cdxIconVolumeOff, cdxIconVolumeUp, cdxIconWatchlist, cdxIconWikitext, cdxIconWindow, cdxIconZoomIn, cdxIconZoomOut
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- To specify all values, use *.
- Get icons for cdxIconInfo and cdxIconTrash
- api.php?action=query&list=codexicons&names=cdxIconInfo|cdxIconTrash [open in sandbox]
list=deletedrevs (dr)
- This module is deprecated.
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List deleted revisions.
Operates in three modes:
- List deleted revisions for the given titles, sorted by timestamp.
- List deleted contributions for the given user, sorted by timestamp (no titles specified).
- List all deleted revisions in the given namespace, sorted by title and timestamp (no titles specified, druser not set).
Certain parameters only apply to some modes and are ignored in others.
- drstart
The timestamp to start enumerating from.
- Modes: 1, 2
- Type: timestamp (allowed formats)
- drend
The timestamp to stop enumerating at.
- Modes: 1, 2
- Type: timestamp (allowed formats)
- drdir
In which direction to enumerate:
- newer
- List oldest first. Note: drstart has to be before drend.
- older
- List newest first (default). Note: drstart has to be later than drend.
- Modes: 1, 3
- One of the following values: newer, older
- Default: older
- drfrom
Start listing at this title.
- Mode: 3
- drto
Stop listing at this title.
- Mode: 3
- drprefix
Search for all page titles that begin with this value.
- Mode: 3
- drunique
List only one revision for each page.
- Mode: 3
- Type: boolean (details)
- drnamespace
Only list pages in this namespace.
- Mode: 3
- One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- Default: 0
- drtag
Only list revisions tagged with this tag.
- druser
Only list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drexcludeuser
Don't list revisions by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- drprop
Which properties to get:
- revid
- Adds the revision ID of the deleted revision.
- parentid
- Adds the revision ID of the previous revision to the page.
- user
- Adds the user who made the revision.
- userid
- Adds the ID of the user who made the revision.
- comment
- Adds the comment of the revision.
- parsedcomment
- Adds the parsed comment of the revision.
- minor
- Tags if the revision is minor.
- len
- Adds the length (bytes) of the revision.
- sha1
- Adds the SHA-1 (base 16) of the revision.
- content
- Adds the content of the revision. For performance reasons, if this option is used, drlimit is enforced to 50.
- token
- Deprecated. Gives the edit token.
- tags
- Tags for the revision.
- Values (separate with | or alternative): comment, content, len, minor, parentid, parsedcomment, revid, sha1, tags, user, userid, token
- Default: user|comment
- drlimit
The maximum amount of revisions to list. If drprop=content is used, the limit is 50.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- drcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List the last deleted revisions of the pages Main Page and Talk:Main Page, with content (mode 1).
- api.php?action=query&list=deletedrevs&titles=Main%20Page|Talk%3AMain%20Page&drprop=user|comment|content [open in sandbox]
- List the last 50 deleted contributions by Bob (mode 2).
- api.php?action=query&list=deletedrevs&druser=Bob&drlimit=50 [open in sandbox]
- List the first 50 deleted revisions in the main namespace (mode 3).
- api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50 [open in sandbox]
- List the first 50 deleted pages in the Talk namespace (mode 3).
- api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50&drnamespace=1&drunique= [open in sandbox]
list=embeddedin (ei)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that embed (transclude) the given title.
- eititle
Title to search. Cannot be used together with eipageid.
- eipageid
Page ID to search. Cannot be used together with eititle.
- Type: integer
- eicontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- einamespace
The namespace to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- eidir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- eifilterredir
How to filter for redirects.
- One of the following values: all, nonredirects, redirects
- Default: all
- eilimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Show pages transcluding Template:Stub.
- api.php?action=query&list=embeddedin&eititle=Template:Stub [open in sandbox]
- Get information about pages transcluding Template:Stub.
- api.php?action=query&generator=embeddedin&geititle=Template:Stub&prop=info [open in sandbox]
list=exturlusage (eu)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate pages that contain a given URL.
- euprop
Which pieces of information to include:
- ids
- Adds the ID of page.
- title
- Adds the title and namespace ID of the page.
- url
- Adds the URL used in the page.
- Values (separate with | or alternative): ids, title, url
- Default: ids|title|url
- eucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- euprotocol
Protocol of the URL. If empty and euquery is set, the protocol is http and https. Leave both this and euquery empty to list all external links.
- One of the following values: Can be empty, or bitcoin, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
- Default: (empty)
- euquery
Search string without protocol. See Special:LinkSearch. Leave empty to list all external links.
- eunamespace
The page namespaces to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- eulimit
How many pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- euexpandurl
- Deprecated.
Expand protocol-relative URLs with the canonical protocol.
- Type: boolean (details)
list=filearchive (fa)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all deleted files sequentially.
- fafrom
The image title to start enumerating from.
- fato
The image title to stop enumerating at.
- faprefix
Search for all image titles that begin with this value.
- fadir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- fasha1
SHA1 hash of image. Overrides fasha1base36.
- fasha1base36
SHA1 hash of image in base 36 (used in MediaWiki).
- faprop
Which image information to get:
- sha1
- Adds SHA-1 hash for the image.
- timestamp
- Adds timestamp for the uploaded version.
- user
- Adds user who uploaded the image version.
- size
- Adds the size of the image in bytes and the height, width and page count (if applicable).
- dimensions
- Alias for size.
- description
- Adds description of the image version.
- parseddescription
- Parse the description of the version.
- mime
- Adds MIME of the image.
- mediatype
- Adds the media type of the image.
- metadata
- Lists Exif metadata for the version of the image.
- bitdepth
- Adds the bit depth of the version.
- archivename
- Adds the filename of the archive version for non-latest versions.
- Values (separate with | or alternative): archivename, bitdepth, description, dimensions, mediatype, metadata, mime, parseddescription, sha1, size, timestamp, user
- Default: timestamp
- falimit
How many images to return in total.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- facontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Show a list of all deleted files.
- api.php?action=query&list=filearchive [open in sandbox]
list=gadgetcategories (gc)
- This module requires read rights.
- Source: Gadgets
- License: GPL-2.0-or-later
Returns a list of gadget sections.
- gcprop
What gadget section information to get:
- name
- Internal section name.
- title
- Section title.
- members
- Number of gadgets in section.
- Values (separate with | or alternative): members, name, title
- Default: name
- gcnames
Names of sections to retrieve.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get a list of existing gadget sections
- api.php?action=query&list=gadgetcategories [open in sandbox]
- Get all information about sections named "foo" and "bar"
- api.php?action=query&list=gadgetcategories&gcnames=foo|bar&gcprop=name|title|members [open in sandbox]
list=gadgets (ga)
- This module requires read rights.
- Source: Gadgets
- License: GPL-2.0-or-later
Returns a list of gadgets used on this wiki.
- gaprop
What gadget information to get:
- id
- Internal gadget ID.
- metadata
- The gadget metadata.
- desc
- Gadget description transformed into HTML (can be slow, use only if really needed).
- Values (separate with | or alternative): desc, id, metadata
- Default: id|metadata
- gacategories
Gadgets from what categories to retrieve.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- gaids
IDs of gadgets to retrieve.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- gaallowedonly
List only gadgets allowed to current user.
- Type: boolean (details)
- gaenabledonly
List only gadgets enabled by current user.
- Type: boolean (details)
- Get a list of gadgets along with their descriptions
- api.php?action=query&list=gadgets&gaprop=id|desc [open in sandbox]
- Get a list of gadgets with all possible properties
- api.php?action=query&list=gadgets&gaprop=id|metadata|desc [open in sandbox]
- Get a list of gadgets belonging to category "foo"
- api.php?action=query&list=gadgets&gacategories=foo [open in sandbox]
- Get information about gadgets "foo" and "bar"
- api.php?action=query&list=gadgets&gaids=foo|bar&gaprop=id|desc|metadata [open in sandbox]
- Get a list of gadgets enabled by current user
- api.php?action=query&list=gadgets&gaenabledonly [open in sandbox]
list=imageusage (iu)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that use the given image title.
- iutitle
Title to search. Cannot be used together with iupageid.
- iupageid
Page ID to search. Cannot be used together with iutitle.
- Type: integer
- iucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iunamespace
The namespace to enumerate.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- iudir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- iufilterredir
How to filter for redirects. If set to nonredirects when iuredirect is enabled, this is only applied to the second level.
- One of the following values: all, nonredirects, redirects
- Default: all
- iulimit
How many total pages to return. If iuredirect is enabled, the limit applies to each level separately (which means up to 2 * iulimit results may be returned).
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- iuredirect
If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.
- Type: boolean (details)
- Show pages using File:Albert Einstein Head.jpg.
- api.php?action=query&list=imageusage&iutitle=File:Albert%20Einstein%20Head.jpg [open in sandbox]
- Get information about pages using File:Albert Einstein Head.jpg.
- api.php?action=query&generator=imageusage&giutitle=File:Albert%20Einstein%20Head.jpg&prop=info [open in sandbox]
list=iwbacklinks (iwbl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given interwiki link.
Can be used to find all links with a prefix, or all links to a title (with a given prefix). Using neither parameter is effectively "all interwiki links".
- iwblprefix
Prefix for the interwiki.
- iwbltitle
Interwiki link to search for. Must be used with iwblblprefix.
- iwblcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- iwbllimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- iwblprop
Which properties to get:
- iwprefix
- Adds the prefix of the interwiki.
- iwtitle
- Adds the title of the interwiki.
- Values (separate with | or alternative): iwprefix, iwtitle
- Default: (empty)
- iwbldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get pages linking to wikibooks:Test.
- api.php?action=query&list=iwbacklinks&iwbltitle=Test&iwblprefix=wikibooks [open in sandbox]
- Get information about pages linking to wikibooks:Test.
- api.php?action=query&generator=iwbacklinks&giwbltitle=Test&giwblprefix=wikibooks&prop=info [open in sandbox]
list=langbacklinks (lbl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Find all pages that link to the given language link.
Can be used to find all links with a language code, or all links to a title (with a given language). Using neither parameter is effectively "all language links".
Note that this may not consider language links added by extensions.
- lbllang
Language for the language link.
- lbltitle
Language link to search for. Must be used with lbllang.
- lblcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- lbllimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lblprop
Which properties to get:
- lllang
- Adds the language code of the language link.
- lltitle
- Adds the title of the language link.
- Values (separate with | or alternative): lllang, lltitle
- Default: (empty)
- lbldir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- Get pages linking to fr:Test.
- api.php?action=query&list=langbacklinks&lbltitle=Test&lbllang=fr [open in sandbox]
- Get information about pages linking to fr:Test.
- api.php?action=query&generator=langbacklinks&glbltitle=Test&glbllang=fr&prop=info [open in sandbox]
list=linterrors (lnt)
- This module requires read rights.
- Source: Linter
- License: GPL-2.0-or-later
Get a list of lint errors
- lntcategories
Categories of lint errors
- Values (separate with | or alternative): bogus-image-options, deletable-table-tag, duplicate-ids, empty-heading, fostered, fostered-transparent, html5-misnesting, large-tables, misc-tidy-replacement-issues, misnested-tag, missing-end-tag, missing-end-tag-in-heading, multi-colon-escape, multiline-html-table-in-list, multiple-unclosed-formatting-tags, night-mode-unaware-background-color, obsolete-tag, pwrap-bug-workaround, self-closed-tag, stripped-tag, template-arg-in-extension-tag, tidy-font-bug, tidy-whitespace-bug, unclosed-quotes-in-heading, wikilink-in-extlink
- Default: deletable-table-tag|duplicate-ids|html5-misnesting|misc-tidy-replacement-issues|multiline-html-table-in-list|multiple-unclosed-formatting-tags|pwrap-bug-workaround|self-closed-tag|template-arg-in-extension-tag|tidy-font-bug|tidy-whitespace-bug|unclosed-quotes-in-heading|bogus-image-options|fostered|misnested-tag|multi-colon-escape|wikilink-in-extlink|empty-heading|missing-end-tag|missing-end-tag-in-heading|night-mode-unaware-background-color|obsolete-tag|stripped-tag
- lntlimit
Number of results to query
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lntnamespace
Only include lint errors from the specified namespaces
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- lntpageid
Only include lint errors from the specified page IDs
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- lnttitle
Only include lint errors from the specified page title
- lntfrom
Lint ID to start querying from
- Type: integer
- Get all lint errors of the obsolete-tag category
- api.php?action=query&list=linterrors&lntcategories=obsolete-tag [open in sandbox]
list=logevents (le)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get events from logs.
- leprop
Which properties to get:
- ids
- Adds the ID of the log event.
- title
- Adds the title of the page for the log event.
- type
- Adds the type of log event.
- user
- Adds the user responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Adds the user ID who was responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
- timestamp
- Adds the timestamp for the log event.
- comment
- Adds the comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds the parsed comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
- details
- Lists additional details about the log event. If the log event has been revision deleted, an actionhidden property will be returned.
- tags
- Lists tags for the log event.
- Values (separate with | or alternative): comment, details, ids, parsedcomment, tags, timestamp, title, type, user, userid
- Default: ids|title|type|user|timestamp|comment|details
- letype
Filter log entries to only this type.
- One of the following values: Can be empty, or abusefilter, abusefilter-protected-vars, abusefilterblockeddomainhit, abusefilterprivatedetails, block, checkuser-temporary-account, contentmodel, create, delete, import, interwiki, ipinfo, managetags, merge, move, newusers, oath, patrol, protect, renameuser, rights, spamblacklist, suppress, tag, thanks, titleblacklist, upload
- leaction
Filter log actions to only this action. Overrides letype. In the list of possible values, values with the asterisk wildcard such as action/* can have different strings after the slash (/).
- One of the following values: abusefilter-protected-vars/*, abusefilter/create, abusefilter/hit, abusefilter/modify, abusefilterblockeddomainhit/*, abusefilterprivatedetails/access, block/block, block/reblock, block/unblock, checkuser-private-event/*, checkuser-temporary-account/*, contentmodel/change, contentmodel/new, create/create, delete/delete, delete/delete_redir, delete/delete_redir2, delete/event, delete/restore, delete/revision, import/interwiki, import/upload, interwiki/iw_add, interwiki/iw_delete, interwiki/iw_edit, ipinfo/*, managetags/activate, managetags/create, managetags/deactivate, managetags/delete, merge/merge, merge/merge-into, move/move, move/move_redir, newusers/autocreate, newusers/byemail, newusers/create, newusers/create2, newusers/newusers, oath/*, patrol/autopatrol, patrol/patrol, protect/modify, protect/move_prot, protect/protect, protect/unprotect, renameuser/renameuser, rights/autopromote, rights/blockautopromote, rights/restoreautopromote, rights/rights, spamblacklist/*, suppress/block, suppress/delete, suppress/event, suppress/hide-afl, suppress/reblock, suppress/revision, suppress/unhide-afl, tag/update, thanks/*, titleblacklist/*, upload/overwrite, upload/revert, upload/upload
- lestart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- leend
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- ledir
In which direction to enumerate:
- newer
- List oldest first. Note: lestart has to be before leend.
- older
- List newest first (default). Note: lestart has to be later than leend.
- One of the following values: newer, older
- Default: older
- leids
Filter entries to those matching the given log ID(s).
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- leuser
Filter entries to those made by the given user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- letitle
Filter entries to those related to a page.
- lenamespace
Filter entries to those in the given namespace.
- One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- leprefix
Filter entries that start with this prefix.
- letag
Only list event entries tagged with this tag.
- lelimit
How many total event entries to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- lecontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List recent log events.
- api.php?action=query&list=logevents [open in sandbox]
list=mystashedfiles (msf)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get a list of files in the current user's upload stash.
- msfprop
Which properties to fetch for the files.
- size
- Fetch the file size and image dimensions.
- type
- Fetch the file's MIME type and media type.
- Values (separate with | or alternative): size, type
- Default: (empty)
- msflimit
How many files to get.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- msfcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get the filekey, file size, and pixel size of files in the current user's upload stash.
- api.php?action=query&list=mystashedfiles&msfprop=size [open in sandbox]
list=pagepropnames (ppn)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all page property names in use on the wiki.
- ppncontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- ppnlimit
The maximum number of names to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- Get first 10 property names.
- api.php?action=query&list=pagepropnames [open in sandbox]
list=pageswithprop (pwp)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all pages using a given page property.
- pwppropname
Page property for which to enumerate pages (action=query&list=pagepropnames returns page property names in use).
- This parameter is required.
- pwpprop
Which pieces of information to include:
- ids
- Adds the page ID.
- title
- Adds the title and namespace ID of the page.
- value
- Adds the value of the page property.
- Values (separate with | or alternative): ids, title, value
- Default: ids|title
- pwpcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- pwplimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- pwpdir
In which direction to sort.
- One of the following values: ascending, descending
- Default: ascending
- List the first 10 pages using
{{DISPLAYTITLE:}}. - api.php?action=query&list=pageswithprop&pwppropname=displaytitle&pwpprop=ids|title|value [open in sandbox]
- Get additional information about the first 10 pages using
__NOTOC__. - api.php?action=query&generator=pageswithprop&gpwppropname=notoc&prop=info [open in sandbox]
list=prefixsearch (ps)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Perform a prefix search for page titles.
Despite the similarity in names, this module is not intended to be equivalent to Special:PrefixIndex; for that, see action=query&list=allpages with the apprefix parameter. The purpose of this module is similar to action=opensearch: to take user input and provide the best-matching titles. Depending on the search engine backend, this might include typo correction, redirect avoidance, or other heuristics.
- pssearch
Search string.
- This parameter is required.
- psnamespace
Namespaces to search. Ignored if pssearch begins with a valid namespace prefix.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- Default: 0
- pslimit
Maximum number of results to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- psoffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- The value must be no less than 0.
- Default: 0
- Search for page titles beginning with meaning.
- api.php?action=query&list=prefixsearch&pssearch=meaning [open in sandbox]
list=protectedtitles (pt)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
List all titles protected from creation.
- ptnamespace
Only list titles in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- ptlevel
Only list titles with these protection levels.
- Values (separate with | or alternative): autoconfirmed, sysop
- ptlimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ptdir
In which direction to enumerate:
- newer
- List oldest first. Note: ptstart has to be before ptend.
- older
- List newest first (default). Note: ptstart has to be later than ptend.
- One of the following values: newer, older
- Default: older
- ptstart
Start listing at this protection timestamp.
- Type: timestamp (allowed formats)
- ptend
Stop listing at this protection timestamp.
- Type: timestamp (allowed formats)
- ptprop
Which properties to get:
- timestamp
- Adds the timestamp of when protection was added.
- user
- Adds the user that added the protection.
- userid
- Adds the user ID that added the protection.
- comment
- Adds the comment for the protection.
- parsedcomment
- Adds the parsed comment for the protection.
- expiry
- Adds the timestamp of when the protection will be lifted.
- level
- Adds the protection level.
- Values (separate with | or alternative): comment, expiry, level, parsedcomment, timestamp, user, userid
- Default: timestamp|level
- ptcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List protected titles.
- api.php?action=query&list=protectedtitles [open in sandbox]
- Find links to protected titles in the main namespace.
- api.php?action=query&generator=protectedtitles&gptnamespace=0&prop=linkshere [open in sandbox]
list=querypage (qp)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get a list provided by a QueryPage-based special page.
- qppage
The name of the special page. Note, this is case-sensitive.
- This parameter is required.
- One of the following values: Ancientpages, BrokenRedirects, Deadendpages, DoubleRedirects, Fewestrevisions, GadgetUsage, LintTemplateErrors, ListDuplicatedFiles, Listredirects, Lonelypages, Longpages, MediaStatistics, Mostcategories, Mostimages, Mostinterwikis, Mostlinked, Mostlinkedcategories, Mostlinkedtemplates, Mostrevisions, Shortpages, Uncategorizedcategories, Uncategorizedimages, Uncategorizedpages, Uncategorizedtemplates, UnconnectedPages, Unusedcategories, Unusedimages, Unusedtemplates, Unwatchedpages, Wantedcategories, Wantedfiles, Wantedpages, Wantedtemplates, Withoutinterwiki
- qpoffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- Default: 0
- qplimit
Number of results to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
list=random (rn)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get a set of random pages.
Pages are listed in a fixed sequence, only the starting point is random. This means that if, for example, Main Page is the first random page in the list, List of fictional monkeys will always be second, List of people on stamps of Vanuatu third, etc.
- rnnamespace
Return pages in these namespaces only.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- rnfilterredir
How to filter for redirects.
- One of the following values: all, nonredirects, redirects
- Default: nonredirects
- rnminsize
Limit to pages with at least this many bytes.
- Type: integer
- rnmaxsize
Limit to pages with at most this many bytes.
- Type: integer
- rncontentmodel
Filter pages that have the specified content model.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- rnredirect
- Deprecated.
Use rnfilterredir=redirects instead.
- Type: boolean (details)
- rnlimit
Limit how many random pages will be returned.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 1
- rncontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Return two random pages from the main namespace.
- api.php?action=query&list=random&rnnamespace=0&rnlimit=2 [open in sandbox]
- Return page info about two random pages from the main namespace.
- api.php?action=query&generator=random&grnnamespace=0&grnlimit=2&prop=info [open in sandbox]
- Return page info about one random page from the main namespace that has at least 500 bytes of text.
- api.php?action=query&list=random&rnnamespace=0&rnlimit=1&minsize=500 [open in sandbox]
list=recentchanges (rc)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate recent changes.
- rcstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- rcend
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- rcdir
In which direction to enumerate:
- newer
- List oldest first. Note: rcstart has to be before rcend.
- older
- List newest first (default). Note: rcstart has to be later than rcend.
- One of the following values: newer, older
- Default: older
- rcnamespace
Filter changes to only these namespaces.
- Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- rcuser
Only list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rcexcludeuser
Don't list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- rctag
Only list changes tagged with this tag.
- rcprop
Include additional pieces of information:
- user
- Adds the user responsible for the edit and tags if they are an IP. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Adds the user ID responsible for the edit. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Adds the comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds the parsed comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- flags
- Adds flags for the edit.
- timestamp
- Adds timestamp of the edit.
- title
- Adds the page title of the edit.
- ids
- Adds the page ID, recent changes ID and the new and old revision ID.
- sizes
- Adds the new and old page length in bytes.
- redirect
- Tags edit if page is a redirect.
- patrolled
- Tags patrollable edits as being patrolled or unpatrolled.
- loginfo
- Adds log information (log ID, log type, etc) to log entries.
- tags
- Lists tags for the entry.
- sha1
- Adds the content checksum for entries associated with a revision. If the content has been revision deleted, a sha1hidden property will be returned.
- Values (separate with | or alternative): comment, flags, ids, loginfo, parsedcomment, patrolled, redirect, sha1, sizes, tags, timestamp, title, user, userid
- Default: title|timestamp|ids
- rcshow
Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set rcshow=minor|!anon.
- Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !redirect, anon, autopatrolled, bot, minor, patrolled, redirect, unpatrolled
- rclimit
How many total changes to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- rctype
Which types of changes to show.
- Values (separate with | or alternative): categorize, edit, external, log, new
- Default: edit|new|log|categorize
- rctoponly
Only list changes which are the latest revision.
- Type: boolean (details)
- rctitle
Filter entries to those related to a page.
- rccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- rcgeneraterevisions
When being used as a generator, generate revision IDs rather than titles. Recent change entries without associated revision IDs (e.g. most log entries) will generate nothing.
- Type: boolean (details)
- rcslot
Only list changes that touch the named slot.
- One of the following values: main
- List recent changes.
- api.php?action=query&list=recentchanges [open in sandbox]
- Get page info about recent unpatrolled changes.
- api.php?action=query&generator=recentchanges&grcshow=!patrolled&prop=info [open in sandbox]
list=search (sr)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Perform a full text search.
- srsearch
Search for page titles or content matching this value. You can use the search string to invoke special search features, depending on what the wiki's search backend implements.
- This parameter is required.
- srnamespace
Search only within these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- Default: 0
- srlimit
How many total pages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- sroffset
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Type: integer
- The value must be no less than 0.
- Default: 0
- srqiprofile
Query independent profile to use (affects ranking algorithm).
- classic
- Ranking based on the number of incoming links, some templates, page language and recency (templates/language/recency may not be activated on this wiki).
- classic_noboostlinks
- Ranking based on some templates, page language and recency when activated on this wiki.
- empty
- Ranking based solely on query dependent features (for debug only).
- wsum_inclinks
- Weighted sum based on incoming links
- wsum_inclinks_pv
- Weighted sum based on incoming links and weekly pageviews
- popular_inclinks_pv
- Ranking based primarily on page views
- popular_inclinks
- Ranking based primarily on incoming link counts
- engine_autoselect
- Let the search engine decide on the best profile to use.
- One of the following values: classic, classic_noboostlinks, empty, engine_autoselect, popular_inclinks, popular_inclinks_pv, wsum_inclinks, wsum_inclinks_pv
- Default: engine_autoselect
- srqdprofile
Query dependent profile to use (affects ranking algorithm).
- default
- (no description)
- perfield_builder
- (no description)
- perfield_builder_relaxed
- (no description)
- perfield_builder_title_filter
- (no description)
- engine_autoselect
- Let the search engine decide on the best profile to use.
- One of the following values: default, engine_autoselect, perfield_builder, perfield_builder_relaxed, perfield_builder_title_filter
- Default: engine_autoselect
- srwhat
Which type of search to perform.
- One of the following values: nearmatch, text, title
- srinfo
Which metadata to return.
- Values (separate with | or alternative): rewrittenquery, suggestion, totalhits
- Default: totalhits|suggestion|rewrittenquery
- srprop
Which properties to return:
- size
- Adds the size of the page in bytes.
- wordcount
- Adds the word count of the page.
- timestamp
- Adds the timestamp of when the page was last edited.
- snippet
- Adds a snippet of the page, with query term highlighting markup.
- titlesnippet
- Adds the page title, with query term highlighting markup.
- redirecttitle
- Adds the title of the matching redirect.
- redirectsnippet
- Adds the title of the matching redirect, with query term highlighting markup.
- sectiontitle
- Adds the title of the matching section.
- sectionsnippet
- Adds the title of the matching section, with query term highlighting markup.
- isfilematch
- Adds a boolean indicating if the search matched file content.
- categorysnippet
- Adds the matching category name, with query term highlighting markup.
- score
- Deprecated. Ignored.
- hasrelated
- Deprecated. Ignored.
- extensiondata
- Adds extra data generated by extensions.
- Values (separate with | or alternative): categorysnippet, extensiondata, isfilematch, redirectsnippet, redirecttitle, sectionsnippet, sectiontitle, size, snippet, timestamp, titlesnippet, wordcount, hasrelated, score
- Default: size|wordcount|timestamp|snippet
- srinterwiki
Include interwiki results in the search, if available.
- Type: boolean (details)
- srenablerewrites
Enable internal query rewriting. Some search backends can rewrite the query into another which is thought to provide better results, for instance by correcting spelling errors.
- Type: boolean (details)
- srsort
Set the sort order of returned results.
- One of the following values: create_timestamp_asc, create_timestamp_desc, incoming_links_asc, incoming_links_desc, just_match, last_edit_asc, last_edit_desc, none, random, relevance, user_random
- Default: relevance
- Search for meaning.
- api.php?action=query&list=search&srsearch=meaning [open in sandbox]
- Search texts for meaning.
- api.php?action=query&list=search&srwhat=text&srsearch=meaning [open in sandbox]
- Get page info about the pages returned for a search for meaning.
- api.php?action=query&generator=search&gsrsearch=meaning&prop=info [open in sandbox]
list=tags (tg)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
List change tags.
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
The maximum number of tags to list.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
Which properties to get:
- displayname
- Adds the displayed name of the tag. This property will be omitted for hidden tags.
- description
- Adds the description of the tag.
- hitcount
- Adds the number of revisions and log entries that have this tag.
- defined
- Indicate whether the tag is defined (see source).
- source
- Gets the sources of the tag definition, which may include software for software-defined tags and manual for tags that may be applied manually by users.
- active
- Whether the tag is still being applied by the software, or may still be applied by users.
- Values (separate with | or alternative): active, defined, description, displayname, hitcount, source
- Default: (empty)
list=trackingcategories (tc)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- tccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- tctrackingcatname
Search for all existing tracking category titles that match the provided tracking category name (as defined by "message name" on Special:TrackingCategories.)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- tcmin
Only return existing tracking categories with at least this many members.
- Type: integer
- tcmax
Only return existing tracking categories with at most this many members.
- Type: integer
- tclimit
How many tracking categories to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- tcprop
Which properties to get:
- size
- Adds number of pages in the tracking category.
- hidden
- Tags tracking categories that are hidden with
__HIDDENCAT__.
- Values (separate with | or alternative): hidden, size
- Default: (empty)
- List tracking categories with information on the number of pages in each.
- api.php?action=query&list=trackingcategories&tcprop=size [open in sandbox]
- Retrieve info about the tracking category pages representing the broken-file-category themselves, if they exist
- api.php?action=query&generator=trackingcategories>ctrackingcatname=broken-file-category&prop=info [open in sandbox]
list=usercontribs (uc)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get all edits by a user.
- uclimit
The maximum number of contributions to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- ucstart
The start timestamp to return from, i.e. revisions before this timestamp.
- Type: timestamp (allowed formats)
- ucend
The end timestamp to return to, i.e. revisions after this timestamp.
- Type: timestamp (allowed formats)
- uccontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- ucuser
The users to retrieve contributions for. Cannot be used with ucuserids, ucuserprefix, or uciprange.
- Type: list of users, by any of username, IP, Temporary user and interwiki name (e.g. "prefix>ExampleName")
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ucuserids
The user IDs to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or uciprange.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ucuserprefix
Retrieve contributions for all users whose names begin with this value. Cannot be used with ucuser, ucuserids, or uciprange.
- uciprange
The CIDR range to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or ucuserids.
- ucdir
In which direction to enumerate:
- newer
- List oldest first. Note: ucstart has to be before ucend.
- older
- List newest first (default). Note: ucstart has to be later than ucend.
- One of the following values: newer, older
- Default: older
- ucnamespace
Only list contributions in these namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- ucprop
Include additional pieces of information:
- ids
- Adds the page ID and revision ID.
- title
- Adds the title and namespace ID of the page.
- timestamp
- Adds the timestamp of the edit.
- comment
- Adds the comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds the parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- size
- Adds the new size of the edit.
- sizediff
- Adds the size delta of the edit against its parent.
- flags
- Adds flags of the edit.
- patrolled
- Tags patrolled edits.
- tags
- Lists tags for the edit.
- Values (separate with | or alternative): comment, flags, ids, parsedcomment, patrolled, size, sizediff, tags, timestamp, title
- Default: ids|title|timestamp|comment|size|flags
- ucshow
Show only items that meet these criteria, e.g. non minor edits only: ucshow=!minor.
If ucshow=patrolled or ucshow=!patrolled is set, revisions older than $wgRCMaxAge (7776000 seconds) won't be shown.
- Values (separate with | or alternative): !autopatrolled, !minor, !new, !patrolled, !top, autopatrolled, minor, new, patrolled, top
- uctag
Only list revisions tagged with this tag.
- uctoponly
- Deprecated.
Only list changes which are the latest revision.
- Type: boolean (details)
- Show contributions of user Example.
- api.php?action=query&list=usercontribs&ucuser=Example [open in sandbox]
- Show contributions from all IP addresses with prefix 192.0.2..
- api.php?action=query&list=usercontribs&ucuserprefix=192.0.2. [open in sandbox]
list=users (us)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get information about a list of users.
- usprop
Which pieces of information to include:
- blockinfo
- Tags if the user is blocked, by whom, and for what reason.
- groups
- Lists all the groups each user belongs to.
- groupmemberships
- Lists groups that each user has been explicitly assigned to, including the expiry date of each group membership.
- implicitgroups
- Lists all the groups a user is automatically a member of.
- rights
- Lists all the rights each user has.
- editcount
- Adds the user's edit count.
- registration
- Adds the user's registration timestamp.
- emailable
- Tags if the user can and wants to receive email through Special:Emailuser.
- gender
- Tags the gender of the user. Returns "male", "female", or "unknown".
- centralids
- Adds the central IDs and attachment status for the user.
- cancreate
- Indicates whether an account for valid but unregistered usernames can be created. To check whether the current user can perform the account creation, use action=query&meta=userinfo&uiprop=cancreateaccount.
- tempexpired
- Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
- Values (separate with | or alternative): blockinfo, cancreate, centralids, editcount, emailable, gender, groupmemberships, groups, implicitgroups, registration, rights, tempexpired
- usattachedwiki
With usprop=centralids, indicate whether the user is attached with the wiki identified by this ID.
- ususers
A list of users to obtain information for.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- ususerids
A list of user IDs to obtain information for.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Return information for user Example.
- api.php?action=query&list=users&ususers=Example&usprop=groups|editcount|gender [open in sandbox]
list=watchlist (wl)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get recent changes to pages in the current user's watchlist.
- wlallrev
Include multiple revisions of the same page within given timeframe.
- Type: boolean (details)
- wlstart
The timestamp to start enumerating from.
- Type: timestamp (allowed formats)
- wlend
The timestamp to end enumerating.
- Type: timestamp (allowed formats)
- wlnamespace
Filter changes to only the given namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- wluser
Only list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- wlexcludeuser
Don't list changes by this user.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- wldir
In which direction to enumerate:
- newer
- List oldest first. Note: wlstart has to be before wlend.
- older
- List newest first (default). Note: wlstart has to be later than wlend.
- One of the following values: newer, older
- Default: older
- wllimit
How many total results to return per request.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wlprop
Which additional properties to get:
- ids
- Adds revision IDs and page IDs.
- title
- Adds title of the page.
- flags
- Adds flags for the edit.
- user
- Adds the user who made the edit. If the user has been revision deleted, a userhidden property will be returned.
- userid
- Adds user ID of whoever made the edit. If the user has been revision deleted, a userhidden property will be returned.
- comment
- Adds comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- parsedcomment
- Adds parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
- timestamp
- Adds timestamp of the edit.
- patrol
- Tags edits that are patrolled.
- sizes
- Adds the old and new lengths of the page.
- notificationtimestamp
- Adds timestamp of when the user was last notified about the edit.
- loginfo
- Adds log information where appropriate.
- tags
- Lists tags for the entry.
- expiry
- Adds the expiry time.
- labels
- Adds watchlist labels associated with the entry.
- Values (separate with | or alternative): comment, expiry, flags, ids, labels, loginfo, notificationtimestamp, parsedcomment, patrol, sizes, tags, timestamp, title, user, userid
- Default: ids|title|flags
- wlshow
Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set wlshow=minor|!anon.
- Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !unread, anon, autopatrolled, bot, minor, patrolled, unread
- wltype
Which types of changes to show:
- edit
- Regular page edits.
- new
- Page creations.
- log
- Log entries.
- external
- External changes.
- categorize
- Category membership changes.
- Values (separate with | or alternative): categorize, edit, external, log, new
- Default: edit|new|log|categorize
- wllabels
Only list changes with these watchlist label IDs.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wlowner
Used along with wltoken to access a different user's watchlist.
- Type: user, by username
- wltoken
A security token (available in the user's preferences) to allow access to another user's watchlist.
- wlcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- List the top revision for recently changed pages on the current user's watchlist.
- api.php?action=query&list=watchlist [open in sandbox]
- Fetch additional information about the top revision for recently changed pages on the current user's watchlist.
- api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment [open in sandbox]
- Fetch additional information about the top revision for recently changed pages on the current user's watchlist, including when temporarily watched items will expire.
- api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment|expiry [open in sandbox]
- Fetch information about all recent changes to pages on the current user's watchlist.
- api.php?action=query&list=watchlist&wlallrev=&wlprop=ids|title|timestamp|user|comment [open in sandbox]
- Fetch page info for recently changed pages on the current user's watchlist.
- api.php?action=query&generator=watchlist&prop=info [open in sandbox]
- Fetch revision info for recent changes to pages on the current user's watchlist.
- api.php?action=query&generator=watchlist&gwlallrev=&prop=revisions&rvprop=timestamp|user [open in sandbox]
- List the top revision for recently changed pages on the watchlist of user Example.
- api.php?action=query&list=watchlist&wlowner=Example&wltoken=123ABC [open in sandbox]
list=watchlistraw (wr)
- This module requires read rights.
- This module can be used as a generator.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get all pages on the current user's watchlist.
- wrcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- wrnamespace
Only list pages in the given namespaces.
- Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
- To specify all values, use *.
- wrlimit
How many total results to return per request.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wrprop
Which additional properties to get:
- changed
- Adds timestamp of when the user was last notified about the edit.
- Values (separate with | or alternative): changed
- wrshow
Only list items that meet these criteria.
- Values (separate with | or alternative): !changed, changed
- wrowner
Used along with wrtoken to access a different user's watchlist.
- Type: user, by username
- wrtoken
A security token (available in the user's preferences) to allow access to another user's watchlist.
- wrdir
The direction in which to list.
- One of the following values: ascending, descending
- Default: ascending
- wrfromtitle
Title (with namespace prefix) to begin enumerating from.
- wrtotitle
Title (with namespace prefix) to stop enumerating at.
- List pages on the current user's watchlist.
- api.php?action=query&list=watchlistraw [open in sandbox]
- Fetch page info for pages on the current user's watchlist.
- api.php?action=query&generator=watchlistraw&gwrshow=changed&prop=info [open in sandbox]
list=wblistentityusage (wbleu)
- This module requires read rights.
- This module can be used as a generator.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Returns all pages that use the given entity IDs.
- wbleuprop
Properties to add to the result.
- url
- If enabled the url of the entity will be added to the result.
- Values (separate with | or alternative): url
- wbleuaspect
Only return entity IDs that used this aspect.
- S
- The entity's sitelinks are used
- L
- The entity's label is used
- D
- The entity's description is used
- T
- The title of the local page corresponding to the entity is used
- C
- Statements from the entity are used
- X
- All aspects of an entity are or may be used
- O
- Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
- Values (separate with | or alternative): C, D, L, O, S, T, X
- wbleuentities
Entities that have been used.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wbleulimit
How many entity usages to return.
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wbleucontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get pages that use the entity Q2.
- api.php?action=query&list=wblistentityusage&wbleuentities=Q2 [open in sandbox]
- Get pages that use the entity Q2 with URL included.
- api.php?action=query&list=wblistentityusage&wbleuentities=Q2&wbleuprop=url [open in sandbox]
- Get pages that use the entity Q2 and the aspect was sitelink or statement.
- api.php?action=query&list=wblistentityusage&wbleuentities=Q2&wbleuaspect=S|O [open in sandbox]
list=wbsearch (wbs)
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module can be used as a generator.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Searches for entities using labels and aliases.
This can be used as a generator for other queries. Returns the matched term that should be displayed.
- wbssearch
Search for this text.
- This parameter is required.
- wbslanguage
Search in this language.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- wbsstrictlanguage
Whether to disable language fallback
- Type: boolean (details)
- wbstype
Search for this type of entity.
- One of the following values: item, property
- Default: item
- wbslimit
Maximal number of results
- Type: integer or max
- The value must be between 0 and 50.
- Default: 7
- wbsprofile
The search profile to use.
- default
- The default profile, suitable for most purposes.
- One of the following values: default
- Default: default
- Search for "abc" in English language, with defaults for type and limit
- api.php?action=query&list=wbsearch&wbssearch=abc&wbslanguage=en [open in sandbox]
- Search for "abc" in English language with a limit of 50
- api.php?action=query&list=wbsearch&wbssearch=abc&wbslanguage=en&wbslimit=50 [open in sandbox]
- Search only properties for "alphabet" in English language
- api.php?action=query&list=wbsearch&wbssearch=alphabet&wbslanguage=en&wbstype=property [open in sandbox]
- Search for "alphabet" in English language as a generator
- api.php?action=query&generator=wbsearch&gwbssearch=alphabet&gwbslanguage=en [open in sandbox]
list=wbsubscribers (wbls)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get subscriptions to given entities.
- wblsentities
Entities to get subscribers
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- wblsprop
Properties to add to result
- Values (separate with | or alternative): url
- Default: (empty)
- wblslimit
Maximal number of results
- Type: integer or max
- The value must be between 1 and 500.
- Default: 10
- wblscontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get subscribers to entity Q42
- api.php?action=query&list=wbsubscribers&wblsentities=Q42 [open in sandbox]
- Get subscribers to entity Q42 with URL to
Special:EntityUsageincluded - api.php?action=query&list=wbsubscribers&wblsentities=Q42&wblsprop=url [open in sandbox]
meta=allmessages (am)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return messages from this site.
- ammessages
Which messages to output. * (default) means all messages.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: *
- amprop
Which properties to get.
- Values (separate with | or alternative): default
- amenableparser
Set to enable parser, will preprocess the wikitext of message (substitute magic words, handle templates, etc.).
- Type: boolean (details)
- amnocontent
If set, do not include the content of the messages in the output.
- Type: boolean (details)
- amincludelocal
Also include local messages, i.e. messages that don't exist in the software but do exist as in the MediaWiki namespace. This lists all MediaWiki-namespace pages, so it will also list those that aren't really messages such as Common.js.
- Type: boolean (details)
- amargs
Arguments to be substituted into message.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- amfilter
Return only messages with names that contain this string.
- amcustomised
Return only messages in this customisation state.
- One of the following values: all, modified, unmodified
- Default: all
- amlang
Return messages in this language.
- amfrom
Return messages starting at this message.
- amto
Return messages ending at this message.
- amtitle
Page name to use as context when parsing message (for amenableparser option).
- amprefix
Return messages with this prefix.
- Show messages starting with ipb-.
- api.php?action=query&meta=allmessages&refix=ipb- [open in sandbox]
- Show messages august and mainpage in German.
- api.php?action=query&meta=allmessages&ammessages=august|mainpage&amlang=de [open in sandbox]
meta=authmanagerinfo (ami)
- Source: MediaWiki
- License: GPL-2.0-or-later
Retrieve information about the current authentication status.
- amisecuritysensitiveoperation
Test whether the user's current authentication status is sufficient for the specified security-sensitive operation.
- amirequestsfor
Fetch information about the authentication requests needed for the specified authentication action.
- One of the following values: change, create, create-continue, link, link-continue, login, login-continue, remove, unlink
- amimergerequestfields
Merge field information for all authentication requests into one array.
- Type: boolean (details)
- amimessageformat
Format to use for returning messages.
- One of the following values: html, none, raw, wikitext
- Default: wikitext
- Fetch the requests that may be used when beginning a login.
- api.php?action=query&meta=authmanagerinfo&amirequestsfor=login [open in sandbox]
- Fetch the requests that may be used when beginning a login, with form fields merged.
- api.php?action=query&meta=authmanagerinfo&amirequestsfor=login&amimergerequestfields=1 [open in sandbox]
- Test whether authentication is sufficient for action foo.
- api.php?action=query&meta=authmanagerinfo&amisecuritysensitiveoperation=foo [open in sandbox]
meta=checkuserformattedblockinfo
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: CheckUser
- License: GPL-2.0-or-later
Return formatted block details for sitewide blocks affecting the current user.
meta=filerepoinfo (fri)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return meta information about image repositories configured on the wiki.
- friprop
Which repository properties to get (properties available may vary on other wikis).
- canUpload
- Whether files can be uploaded to this repository, e.g. via CORS and shared authentication.
- displayname
- The human-readable name of the repository wiki.
- favicon
- Repository wiki's favicon URL, from $wgFavicon.
- initialCapital
- Whether file names implicitly start with a capital letter.
- local
- Whether that repository is the local one or not.
- name
- The key of the repository - used in e.g. $wgForeignFileRepos and imageinfo return values.
- rootUrl
- Root URL path for image paths.
- scriptDirUrl
- Root URL path for the repository wiki's MediaWiki installation.
- thumbUrl
- Root URL path for thumbnail paths.
- url
- Public zone URL path.
- Values (separate with | or alternative): canUpload, displayname, favicon, initialCapital, local, name, rootUrl, scriptDirUrl, thumbUrl, url
- Default: canUpload|displayname|favicon|initialCapital|local|name|rootUrl|scriptDirUrl|thumbUrl|url
- Get information about file repositories.
- api.php?action=query&meta=filerepoinfo&friprop=name|displayname [open in sandbox]
meta=languageinfo (li)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return information about available languages.
Continuation may be applied if retrieving the information takes too long for one request.
- liprop
Which information to get for each language.
- code
- The language code. (This code is MediaWiki-specific, though there are overlaps with other standards.)
- bcp47
- The BCP-47 language code.
- dir
- The writing direction of the language (either
ltrorrtl). - autonym
- The autonym of the language, that is, the name in that language.
- name
- The name of the language in the language specified by the uselang parameter, with language fallbacks applied if necessary.
- variantnames
- The short names for language variants used for language conversion links.
- fallbacks
- The language codes of the fallback languages configured for this language. The implicit final fallback to 'en' is not included (but some languages may fall back to 'en' explicitly).
- variants
- The language codes of the variants supported by this language.
- Values (separate with | or alternative): autonym, bcp47, code, dir, fallbacks, name, variantnames, variants
- Default: code
- licode
Language codes of the languages that should be returned, or
*for all languages.- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: *
- licontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- Get the language codes of all supported languages.
- api.php?action=query&meta=languageinfo [open in sandbox]
- Get the autonyms and German names of all supported languages.
- api.php?action=query&meta=languageinfo&liprop=autonym|name&uselang=de [open in sandbox]
- Get the fallback languages and variants of Occitan.
- api.php?action=query&meta=languageinfo&liprop=fallbacks|variants&licode=oc [open in sandbox]
- Get the BCP-47 language code and direction of all supported languages.
- api.php?action=query&meta=languageinfo&liprop=bcp47|dir [open in sandbox]
meta=linterstats (lntrst)
- This module requires read rights.
- Source: Linter
- License: GPL-2.0-or-later
Get number of lint errors in each category
- Get number of lint errors in each category
- api.php?action=query&meta=linterstats [open in sandbox]
meta=notifications (not)
- This module requires read rights.
- Source: Echo
- License: MIT
Get notifications waiting for the current user.
- notfilter
Filter notifications returned.
- Values (separate with | or alternative): !read, read
- Default: read|!read
- notprop
Details to request.
- Values (separate with | or alternative): count, list, seenTime
- Default: list
- notsections
The notification sections to query (i.e. some combination of 'alert' and 'message').
- Values (separate with | or alternative): alert, message
- Default: alert|message
- notgroupbysection
Whether to group the result by section. Each section is fetched separately if set.
- Type: boolean (details)
- notformat
If specified, notifications will be returned formatted this way.
- model
- Raw notification data
- special
- Formatted for Special:Notifications page (and only that!) Do not rely on the HTML as it may change at any given time.
- flyout
- Deprecated. Use notformat=model for raw data
- html
- Deprecated. Use notformat=model for raw data
- One of the following values: flyout, html, model, special
- notlimit
The maximum number of notifications to return.
- Type: integer or max
- The value must be between 1 and 50.
- Default: 20
- notcontinue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- notunreadfirst
Whether to show unread notifications first (only used if groupbysection is not set).
- Type: boolean (details)
- nottitles
Only return notifications for these pages. To get notifications not associated with any page, use [] as a title.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- notbundle
Whether to show bundle compatible unread notifications according to notification types bundling rules.
- Type: boolean (details)
- notnotifiertypes
Notifier types for which to return notifications.
- Values (separate with | or alternative): email, web
- Default: web
- notalertcontinue
When more alert results are available, use this to continue.
- notalertunreadfirst
Whether to show unread message notifications first (only used if groupbysection is set).
- Type: boolean (details)
- notmessagecontinue
When more message results are available, use this to continue.
- notmessageunreadfirst
Whether to show unread alert notifications first (only used if groupbysection is set).
- Type: boolean (details)
- List web notifications
- api.php?action=query&meta=notifications [open in sandbox]
- List web notifications, grouped by section, with counts
- api.php?action=query&meta=notifications¬prop=count¬sections=alert|message¬groupbysection=1 [open in sandbox]
- List email notifications
- api.php?action=query&meta=notifications¬notifiertypes=email [open in sandbox]
meta=siteinfo (si)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Return general information about the site.
- siprop
Which information to get:
- general
- Overall system information.
- namespaces
- List of registered namespaces and their canonical names.
- namespacealiases
- List of registered namespace aliases.
- specialpagealiases
- List of special page aliases.
- magicwords
- List of magic words and their aliases.
- interwikimap
- Returns interwiki map (optionally filtered, optionally localised by using siinlanguagecode).
- dbrepllag
- Returns database server with the highest replication lag.
- statistics
- Returns site statistics.
- usergroups
- Returns user groups and the associated permissions.
- autocreatetempuser
- Returns configuration for the automatic creation of temporary user accounts (also known as IP masking).
- clientlibraries
- Returns client-side libraries installed on the wiki
- libraries
- Returns libraries installed on the wiki.
- extensions
- Returns extensions installed on the wiki.
- fileextensions
- Returns list of file extensions (file types) allowed to be uploaded.
- rightsinfo
- Returns wiki rights (license) information if available.
- restrictions
- Returns information on available restriction (protection) types.
- languages
- Returns a list of languages MediaWiki supports (optionally localised by using siinlanguagecode).
- languagevariants
- Returns a list of language codes for which LanguageConverter is enabled, and the variants supported for each.
- skins
- Returns a list of all enabled skins (optionally localised by using siinlanguagecode, otherwise in the content language).
- extensiontags
- Returns a list of parser extension tags.
- functionhooks
- Returns a list of magic word IDs for parser functions.
- showhooks
- Returns a list of all subscribed hooks (contents of $wgHooks).
- variables
- Returns a list of magic word IDs for magic variables.
- doubleunderscores
- Returns a list of magic word IDs for behavior switches.
- protocols
- Returns a list of protocols that are allowed in external links.
- defaultoptions
- Returns the default values for user preferences.
- uploaddialog
- Returns the upload dialog configuration.
- autopromote
- Returns the automatic promotion configuration.
- autopromoteonce
- Returns the automatic promotion configuration that are only done once.
- copyuploaddomains
- Returns the list of allowed copy upload domains
- sbom
- Returns a Software Bill of Materials (SBOM) for the MediaWiki installation in the CycloneDX 1.6 format.
- Values (separate with | or alternative): autocreatetempuser, autopromote, autopromoteonce, clientlibraries, copyuploaddomains, dbrepllag, defaultoptions, doubleunderscores, extensions, extensiontags, fileextensions, functionhooks, general, interwikimap, languages, languagevariants, libraries, magicwords, namespacealiases, namespaces, protocols, restrictions, rightsinfo, sbom, showhooks, skins, specialpagealiases, statistics, uploaddialog, usergroups, variables
- Default: general
- sifilteriw
Return only local or only nonlocal entries of the interwiki map.
- One of the following values: !local, local
- sishowalldb
List all database servers, not just the one lagging the most.
- Type: boolean (details)
- sinumberingroup
Lists the number of users in user groups.
- Type: boolean (details)
- siinlanguagecode
Language code for localised language names (best effort) and skin names.
- Fetch site information.
- api.php?action=query&meta=siteinfo&siprop=general|namespaces|namespacealiases|statistics [open in sandbox]
- Fetch a list of local interwiki prefixes.
- api.php?action=query&meta=siteinfo&siprop=interwikimap&sifilteriw=local [open in sandbox]
- Check the current replication lag.
- api.php?action=query&meta=siteinfo&siprop=dbrepllag&sishowalldb= [open in sandbox]
meta=tokens
- Source: MediaWiki
- License: GPL-2.0-or-later
Gets tokens for data-modifying actions.
- type
Types of token to request.
- Values (separate with | or alternative): createaccount, csrf, login, patrol, rollback, userrights, watch
- To specify all values, use *.
- Default: csrf
- Retrieve a csrf token (the default).
- api.php?action=query&meta=tokens [open in sandbox]
- Retrieve a watch token and a patrol token.
- api.php?action=query&meta=tokens&type=watch|patrol [open in sandbox]
meta=unreadnotificationpages (unp)
- This module requires read rights.
- Source: Echo
- License: MIT
Get pages for which there are unread notifications for the current user.
- unpgrouppages
Group talk pages together with their subject page, and group notifications not associated with a page together with the current user's user page.
- Type: boolean (details)
- unplimit
The maximum number of pages to return.
- Type: integer or max
- The value must be between 1 and 10,000.
- Default: 10
- List pages with (their amount of) unread notifications
- api.php?action=query&meta=unreadnotificationpages [open in sandbox]
meta=userinfo (ui)
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Get information about the current user.
- uiprop
Which pieces of information to include:
- blockinfo
- Tags if the current user is blocked, by whom, and for what reason.
- hasmsg
- Adds a tag messages if the current user has pending messages.
- groups
- Lists all the groups the current user belongs to.
- groupmemberships
- Lists groups that the current user has been explicitly assigned to, including the expiry date of each group membership.
- implicitgroups
- Lists all the groups the current user is automatically a member of.
- rights
- Lists all the rights the current user has.
- changeablegroups
- Lists the groups the current user can add to and remove from.
- options
- Lists all preferences the current user has set.
- editcount
- Adds the current user's edit count.
- ratelimits
- Lists all rate limits applying to the current user.
- theoreticalratelimits
- Lists all rate limits that would apply to the current user if they were not exempt from all ratelimits based on user rights or ip.
- Adds the user's email address and email authentication date.
- realname
- Adds the user's real name.
- acceptlang
- Echoes the
Accept-Languageheader sent by the client in a structured format. - registrationdate
- Adds the user's registration date.
- unreadcount
- Adds the count of unread pages on the user's watchlist (maximum 999; returns 1000+ if more).
- watchlistlabels
- Adds watchlist labels the user has set up.
- centralids
- Adds the central IDs and attachment status for the user.
- latestcontrib
- Adds the date of user's latest contribution.
- cancreateaccount
- Indicates whether the user is allowed to create accounts. To check whether some specific account can be created, use action=query&list=users&usprop=cancreate.
- Values (separate with | or alternative): acceptlang, blockinfo, cancreateaccount, centralids, changeablegroups, editcount, email, groupmemberships, groups, hasmsg, implicitgroups, latestcontrib, options, ratelimits, realname, registrationdate, rights, theoreticalratelimits, unreadcount, watchlistlabels
- To specify all values, use *.
- uiattachedwiki
With uiprop=centralids, indicate whether the user is attached with the wiki identified by this ID.
- Get information about the current user.
- api.php?action=query&meta=userinfo [open in sandbox]
- Get additional information about the current user.
- api.php?action=query&meta=userinfo&uiprop=blockinfo|groups|rights|hasmsg [open in sandbox]
meta=wbcontentlanguages (wbcl)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Returns information about the content languages Wikibase accepts in different contexts.
- wbclcontext
The context in which the content languages should be valid.
- term
- The terms (label, description, aliases) of an entity.
- monolingualtext
- A monolingual text value in a statement.
- One of the following values: monolingualtext, term
- Default: term
- wbclprop
The properties that should be returned about each language.
- code
- The language code.
- autonym
- The autonym of the language, that is, the name of the language in that language. May not be known for all languages.
- name
- The name of the language in the current language (specified via the uselang parameter), with language fallbacks applied if necessary. Usually, at least an English name is known for all content languages Wikibase accepts.
- Values (separate with | or alternative): autonym, code, name
- Default: code
- Get the valid language codes for the terms of an entity.
- api.php?action=query&meta=wbcontentlanguages [open in sandbox]
- Get the valid languages, with language code and autonym, for monolingual text values.
- api.php?action=query&meta=wbcontentlanguages&wbclcontext=monolingualtext&wbclprop=code|autonym [open in sandbox]
meta=wikibase (wb)
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Get information about the Wikibase client and the associated Wikibase repository.
- wbprop
Which properties to get:
- url
- Base URL, script path and article path of the Wikibase repository.
- siteid
- The siteid of this site.
- Values (separate with | or alternative): siteid, url
- Default: url|siteid
- Get URL path and other information about Wikibase client and repository.
- api.php?action=query&meta=wikibase [open in sandbox]
action=removeauthenticationdata
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Remove authentication data for the current user.
- request
Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=remove.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Attempt to remove the current user's data for FooAuthenticationRequest.
- api.php?action=removeauthenticationdata&request=FooAuthenticationRequest&token=123ABC [open in sandbox]
action=resetpassword
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Send a password reset email to a user.
- user
User being reset.
- Type: user, by username
Email address of the user being reset.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Send a password reset email to user Example.
- api.php?action=resetpassword&user=Example&token=123ABC [open in sandbox]
- Send a password reset email for all users with email address user@example.com.
- api.php?action=resetpassword&user=user@example.com&token=123ABC [open in sandbox]
action=revisiondelete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Delete and undelete revisions.
- type
Type of revision deletion being performed.
- This parameter is required.
- One of the following values: archive, filearchive, logging, oldimage, revision
- target
Page title for the revision deletion, if required for the type.
- ids
Identifiers for the revisions to be deleted.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- hide
What to hide for each revision.
- Values (separate with | or alternative): comment, content, user
- show
What to unhide for each revision.
- Values (separate with | or alternative): comment, content, user
- suppress
Whether to suppress data from administrators as well as others.
- One of the following values: no, nochange, yes
- Default: nochange
- reason
Reason for the deletion or undeletion.
Tags to apply to the entry in the deletion log.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Hide content for revision 12345 on the page Main Page.
- api.php?action=revisiondelete&target=Main%20Page&type=revision&ids=12345&hide=content&token=123ABC [open in sandbox]
- Hide all data on log entry 67890 with the reason BLP violation.
- api.php?action=revisiondelete&type=logging&ids=67890&hide=content|comment|user&reason=BLP%20violation&token=123ABC [open in sandbox]
action=rollback
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Undo the last edit to the page.
If the last user who edited the page made multiple edits in a row, they will all be rolled back.
- title
Title of the page to roll back. Cannot be used together with pageid.
- pageid
Page ID of the page to roll back. Cannot be used together with title.
- Type: integer
Tags to apply to the rollback.
- Values (separate with | or alternative):
- user
Name of the user whose edits are to be rolled back.
- This parameter is required.
- Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
- summary
Custom edit summary. If empty, default summary will be used.
- Default: (empty)
- markbot
Mark the reverted edits and the revert as bot edits.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- token
A "rollback" token retrieved from action=query&meta=tokens
For compatibility, the token used in the web UI is also accepted.
- This parameter is required.
- Roll back the last edits to page Main Page by user Example.
- api.php?action=rollback&title=Main%20Page&user=Example&token=123ABC [open in sandbox]
- Roll back the last edits to page Main Page by IP user 192.0.2.5 with summary Reverting vandalism, and mark those edits and the revert as bot edits.
- api.php?action=rollback&title=Main%20Page&user=192.0.2.5&token=123ABC&summary=Reverting%20vandalism&markbot=1 [open in sandbox]
action=rsd
- Source: MediaWiki
- License: GPL-2.0-or-later
Export an RSD (Really Simple Discovery) schema.
- Export the RSD schema.
- api.php?action=rsd [open in sandbox]
action=scribunto-console
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: Scribunto
- License: GPL-2.0-or-later AND MIT
Internal module for servicing XHR requests from the Scribunto console.
- title
The title of the module to test.
- content
The new content of the module.
- session
Session token.
- Type: integer
- question
The next line to evaluate as a script.
- This parameter is required.
- clear
Set to clear the current session state.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=setnotificationtimestamp
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Update the notification timestamp for watched pages.
This affects the highlighting of changed pages in the watchlist and history, and the sending of email when the "Email me when a page or a file on my watchlist is changed" preference is enabled.
- entirewatchlist
Work on all watched pages.
- Type: boolean (details)
- timestamp
Timestamp to which to set the notification timestamp.
- Type: timestamp (allowed formats)
- torevid
Revision to set the notification timestamp to (one page only).
- Type: integer
- newerthanrevid
Revision to set the notification timestamp newer than (one page only).
- Type: integer
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Reset the notification status for the entire watchlist.
- api.php?action=setnotificationtimestamp&entirewatchlist=&token=123ABC [open in sandbox]
- Reset the notification status for Main Page.
- api.php?action=setnotificationtimestamp&titles=Main%20Page&token=123ABC [open in sandbox]
- Set the notification timestamp for Main Page so all edits since 1 January 2012 are unviewed.
- api.php?action=setnotificationtimestamp&titles=Main%20Page×tamp=2012-01-01T00:00:00Z&token=123ABC [open in sandbox]
- Reset the notification status for pages in the User namespace.
- api.php?action=setnotificationtimestamp&generator=allpages&gapnamespace=2&token=123ABC [open in sandbox]
action=setpagelanguage
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change the language of a page.
Changing the language of a page is not allowed on this wiki.
Enable $wgPageLanguageUseDB to use this action.
- title
Title of the page whose language you wish to change. Cannot be used together with pageid.
- pageid
Page ID of the page whose language you wish to change. Cannot be used together with title.
- Type: integer
- lang
Language code of the language to change the page to. Use default to reset the page to the wiki's default content language.
- This parameter is required.
- One of the following values: aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, aig, aln, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, ban, ban-bali, bar, bbc, bbc-latn, bcc, bci, bcl, bdr, be, be-tarask, bew, bg, bgc, bgn, bh, bho, bi, bjn, blk, bm, bn, bo, bol, bpy, bqi, br, brh, bs, btm, bto, bug, bug-bugi, bxr, ca, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, chr, chy, ckb, co, cop, cps, cpx, cpx-hans, cpx-hant, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, default, dga, din, diq, dlg, dsb, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, eo, es, es-formal, et, eu, ext, fa, fat, ff, fi, fit, fj, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, kg, kge, khw, ki, kiu, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mdf, mg, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mui, mwl, my, myv, mzn, nah, nan, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, nia, nit, niu, nl, nl-informal, nmz, nn, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, qug, rgn, rif, rki, rm, rmc, rmy, rn, ro, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shn, shy, shy-latn, si, sjd, sje, sk, skr, skr-arab, sl, sli, sm, sma, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, ss, st, stq, sty, su, sv, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, ti, tig, tk, tl, tly, tn, to, tok, tpi, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, wa, wal, war, wls, wlx, wo, wuu, wuu-hans, wuu-hant, xal, xh, xmf, xsy, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zh, zh-cn, zh-hans, zh-hant, zh-hk, zh-mo, zh-my, zh-sg, zh-tw, zu
- reason
Reason for the change.
Change tags to apply to the log entry resulting from this action.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Change the language of the page Main Page to Basque.
- api.php?action=setpagelanguage&title=Main%20Page&lang=eu&token=123ABC [open in sandbox]
- Change the language of the page with ID 123 to the wiki's default content language.
- api.php?action=setpagelanguage&pageid=123&lang=default&token=123ABC [open in sandbox]
action=spamblacklist
- This module requires read rights.
- Source: SpamBlacklist
- License: GPL-2.0-or-later
Validate one or more URLs against the spam block list.
- url
URLs to validate against the block list.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Check two URLs against the block list
- api.php?action=spamblacklist&url=http://www.example.com/|http://www.example.org/ [open in sandbox]
action=stashedit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Prepare an edit in shared cache.
This is intended to be used via AJAX from the edit form to improve the performance of the page save.
- title
Title of the page being edited.
- This parameter is required.
- section
Section identifier. 0 for the top section, new for a new section.
- sectiontitle
The title for a new section.
- text
Page content.
- stashedtexthash
Page content hash from a prior stash to use instead.
- summary
Change summary.
- Default: (empty)
- contentmodel
Content model of the new content.
- This parameter is required.
- One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
- contentformat
Content serialization format used for the input text.
- This parameter is required.
- One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
- baserevid
Revision ID of the base revision.
- This parameter is required.
- Type: integer
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=tag
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Add or remove change tags from individual revisions or log entries.
- rcid
One or more recent changes IDs from which to add or remove the tag.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revid
One or more revision IDs from which to add or remove the tag.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- logid
One or more log entry IDs from which to add or remove the tag.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- add
Tags to add. Only manually defined tags can be added.
- Values (separate with | or alternative):
- remove
Tags to remove. Only tags that are either manually defined or completely undefined can be removed.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- reason
Reason for the change.
- Default: (empty)
Tags to apply to the log entry that will be created as a result of this action.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Add the vandalism tag to revision ID 123 without specifying a reason
- api.php?action=tag&revid=123&add=vandalism&token=123ABC [open in sandbox]
- Remove the spam tag from log entry ID 123 with the reason Wrongly applied
- api.php?action=tag&logid=123&remove=spam&reason=Wrongly+applied&token=123ABC [open in sandbox]
action=templatedata
- This module requires read rights.
- Source: TemplateData
- License: GPL-2.0-or-later
Fetch data stored by the TemplateData extension.
- includeMissingTitles
Return data about titles even if they are missing or lack TemplateData. By default titles are only returned if they exist and have TemplateData.
- Type: boolean (details)
- doNotIgnoreMissingTitles
- Deprecated.
Return data about titles even if they are missing or lack TemplateData. By default (for backwards compatibility) titles are only returned if they exist and have TemplateData.
- Type: boolean (details)
- lang
Return localized values in this language. By default all available translations are returned.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- Return TemplateData for Template:Foobar, with results if the template does not exist or exists but has no TemplateData
- api.php?action=templatedata&titles=Template:Foobar&includeMissingTitles=1 [open in sandbox]
- Return TemplateData for Template:Phabricator, with no results if the template does not exist or exists but has no TemplateData
- api.php?action=templatedata&titles=Template:Phabricator [open in sandbox]
action=thank
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: Thanks
- License: MIT
Send a thank-you notification to an editor.
- rev
Revision ID to thank someone for. This or 'log' must be provided.
- Type: integer
- The value must be no less than 1.
- log
Log ID to thank someone for. This or 'rev' must be provided.
- Type: integer
- The value must be no less than 1.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- source
A short string describing the source of the request, for example diff or history.
- Send thanks for revision ID 456, with the source being a diff page
- api.php?action=thank&revid=456&source=diff&token=123ABC [open in sandbox]
action=titleblacklist (tb)
- This module requires read rights.
- Source: TitleBlacklist
- License: GPL-2.0-or-later
Validate a page title, filename, or username against the TitleBlacklist.
- tbtitle
The string to validate against the blacklist.
- This parameter is required.
- tbaction
The action to be checked.
- One of the following values: create, createpage, createtalk, edit, move, new-account, upload
- Default: edit
- tbnooverride
Don't try to override the titleblacklist.
- Type: boolean (details)
- Check whether Foo is blacklisted
- api.php?action=titleblacklist&tbtitle=Foo [open in sandbox]
- Check whether Bar is blacklisted for editing
- api.php?action=titleblacklist&tbtitle=Bar&tbaction=edit [open in sandbox]
action=unblock
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Unblock a user.
- id
ID of the block to unblock (obtained through list=blocks). Cannot be used together with user.
- Type: integer
- user
User to unblock. Cannot be used together with id.
- Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
- userid
- Deprecated.
Specify user=#ID instead.
- Type: integer
- reason
Reason for unblock.
- Default: (empty)
Change tags to apply to the entry in the block log.
- Values (separate with | or alternative):
- watchuser
Watch the user's or IP address's user and talk pages.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Unblock block ID #105.
- api.php?action=unblock&id=105 [open in sandbox]
- Unblock user Bob with reason Sorry Bob.
- api.php?action=unblock&user=Bob&reason=Sorry%20Bob [open in sandbox]
action=undelete
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Undelete revisions of a deleted page.
A list of deleted revisions (including timestamps) can be retrieved through prop=deletedrevisions, and a list of deleted file IDs can be retrieved through list=filearchive.
- title
Title of the page to undelete.
- This parameter is required.
- reason
Reason for restoring.
- Default: (empty)
Change tags to apply to the entry in the deletion log.
- Values (separate with | or alternative):
- timestamps
Timestamps of the revisions to undelete. If both timestamps and fileids are empty, all will be undeleted.
- Type: list of timestamps (allowed formats)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- fileids
IDs of the file revisions to restore. If both timestamps and fileids are empty, all will be restored.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- undeletetalk
Undelete all revisions of the associated talk page, if any.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, unwatch, watch
- Default: preferences
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
action=unlinkaccount
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Remove a linked third-party account from the current user.
- request
Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=unlink.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Attempt to remove the current user's link for the provider associated with FooAuthenticationRequest.
- api.php?action=unlinkaccount&request=FooAuthenticationRequest&token=123ABC [open in sandbox]
action=upload
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Upload a file, or get the status of pending uploads.
Several methods are available:
- Upload file contents directly, using the file parameter.
- Upload the file in pieces, using the filesize, chunk, and offset parameters.
- Have the MediaWiki server fetch a file from a URL, using the url parameter.
- Complete an earlier upload that failed due to warnings, was uploaded in pieces, or stored otherwise in the upload stash, using the filekey parameter.
Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending the file or chunk.
- filename
Target filename.
- comment
Upload comment. Also used as the initial page text for new files if text is not specified.
- Default: (empty)
Change tags to apply to the upload log entry and file page revision.
- Values (separate with | or alternative):
- text
Initial page text for new files.
- watch
- Deprecated.
Watch the page.
- Type: boolean (details)
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- One of the following values: nochange, preferences, watch
- Default: preferences
- ignorewarnings
Ignore any warnings.
- Type: boolean (details)
- file
File contents.
- Must be posted as a file upload using multipart/form-data.
- url
URL to fetch the file from.
- filekey
Key that identifies a previous upload that was stashed temporarily.
- sessionkey
- Deprecated.
Same as filekey, maintained for backward compatibility.
- stash
If set, the server will stash the file temporarily instead of adding it to the repository.
- Type: boolean (details)
- filesize
Filesize of entire upload.
- Type: integer
- The value must be between 0 and 104,857,600.
- offset
Offset of chunk in bytes.
- Type: integer
- The value must be no less than 0.
- chunk
Chunk contents.
- Must be posted as a file upload using multipart/form-data.
- async
Make potentially large file operations asynchronous when possible.
- Type: boolean (details)
- checkstatus
Only fetch the upload status for the given file key.
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- Upload from a URL.
- api.php?action=upload&filename=Wiki.png&url=http%3A//upload.wikimedia.org/wikipedia/en/b/bc/Wiki.png&token=123ABC [open in sandbox]
- Complete an upload that failed due to warnings.
- api.php?action=upload&filename=Wiki.png&filekey=filekey&ignorewarnings=1&token=123ABC [open in sandbox]
action=userrights
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Change a user's group membership.
- user
User.
- Type: user, by any of username and user ID (e.g. "#12345")
- userid
- Deprecated.
Specify user=#ID instead.
- Type: integer
- add
Add the user to these groups, or if they are already a member, update the expiry of their membership in that group.
- Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
- expiry
Expiry timestamps. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If only one timestamp is set, it will be used for all groups passed to the add parameter. Use infinite, indefinite, infinity, or never for a never-expiring user group.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Default: infinite
- remove
Remove the user from these groups.
- Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
- reason
Reason for the change.
- Default: (empty)
- token
A "userrights" token retrieved from action=query&meta=tokens
For compatibility, the token used in the web UI is also accepted.
- This parameter is required.
Change tags to apply to the entry in the user rights log.
- Values (separate with | or alternative):
- watchuser
Watch the user's user and talk pages.
- Type: boolean (details)
- Add user FooBot to group bot, and remove from groups sysop and bureaucrat.
- api.php?action=userrights&user=FooBot&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
- Add the user with ID 123 to group bot, and remove from groups sysop and bureaucrat.
- api.php?action=userrights&userid=123&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
- Add user SometimeSysop to group sysop for 1 month.
- api.php?action=userrights&user=SometimeSysop&add=sysop&expiry=1%20month&token=123ABC [open in sandbox]
action=validatepassword
- This module requires read rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Validate a password against the wiki's password policies.
Validity is reported as Good if the password is acceptable, Change if the password may be used for login but must be changed, or Invalid if the password is not usable.
- password
Password to validate.
- This parameter is required.
- user
Username, for use when testing account creation. The named user must not exist.
- Type: user, by any of username and user ID (e.g. "#12345")
Email address, for use when testing account creation.
- realname
Real name, for use when testing account creation.
- Validate the password foobar for the current user.
- api.php?action=validatepassword&password=foobar [open in sandbox]
- Validate the password qwerty for creating user Example.
- api.php?action=validatepassword&password=querty&user=Example [open in sandbox]
action=visualeditor
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: VisualEditor
- License: MIT
Returns HTML5 for a page from the Parsoid service.
- page
The page to perform actions on.
- This parameter is required.
- badetag
If RESTBase query returned a seemingly invalid ETag, pass it here for logging purposes.
- format
The format of the output.
- One of the following values: json, jsonfm
- Default: jsonfm
- paction
Action to perform.
- This parameter is required.
- One of the following values: metadata, parse, parsefragment, templatesused, wikitext
- wikitext
Wikitext to send to Parsoid to convert to HTML (paction=parsefragment).
- section
The section on which to act.
- stash
When saving, set this true if you want to use the stashing API.
- Type: boolean (details)
- oldid
The revision number to use (defaults to latest revision).
- Type: integer
- editintro
Edit intro to add to notices.
- pst
Pre-save transform wikitext before sending it to Parsoid (paction=parsefragment).
- Type: boolean (details)
- preload
The page to use content from if the fetched page has no content yet.
- preloadparams
Parameters to substitute into the preload page, if present.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
action=visualeditoredit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: VisualEditor
- License: MIT
Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- paction
Action to perform.
- This parameter is required.
- One of the following values: diff, save, serialize, serializeforcache
- page
The page to perform actions on.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- wikitext
The wikitext to act with.
- section
The section on which to act.
- sectiontitle
Title for new section.
- basetimestamp
When saving, set this to the timestamp of the revision that was edited. Used to detect edit conflicts.
- Type: timestamp (allowed formats)
- starttimestamp
When saving, set this to the timestamp of when the page was loaded. Used to detect edit conflicts.
- Type: timestamp (allowed formats)
- oldid
The revision number to use. Defaults to latest revision.
- Type: integer
- minor
Flag for minor edit.
- watchlist
Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.
- html
HTML to send to Parsoid in exchange for wikitext.
- etag
ETag to send.
- summary
Edit summary.
- captchaid
Captcha ID (when saving with a captcha response).
- captchaword
Answer to the captcha (when saving with a captcha response).
- cachekey
Use the result of a previous serializeforcache request with this key. Overrides html.
- nocontent
Omit the HTML content of the new revision in the response.
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- useskin
Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.
- One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
Change tags to apply to the edit.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- plugins
Plugins associated with the API request.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- data-{plugin}
Arbitrary data sent by a plugin with the API request.
- This is a templated parameter. When making the request, {plugin} in the parameter's name should be replaced with values of plugins.
action=watch
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: MediaWiki
- License: GPL-2.0-or-later
Add or remove pages from the current user's watchlist.
- title
- Deprecated.
The page to (un)watch. Use titles instead.
- labels
Label IDs to assign to the pages being watched. This will replace all existing labels on the pages with the ones specified.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- unwatch
If set the page will be unwatched rather than watched.
- Type: boolean (details)
- continue
When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.
- titles
A list of titles to work on.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- pageids
A list of page IDs to work on.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- revids
A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.
- Type: list of integers
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generator
Get the list of pages to work on by executing the specified query module.
Note: Generator parameter names must be prefixed with a "g", see examples.
- allcategories
- Enumerate all categories.
- alldeletedrevisions
- List all deleted revisions by a user or in a namespace.
- allfileusages
- List all file usages, including non-existing.
- allimages
- Enumerate all images sequentially.
- alllinks
- Enumerate all links that point to a given namespace.
- allpages
- Enumerate all pages sequentially in a given namespace.
- allredirects
- List all redirects to a namespace.
- allrevisions
- List all revisions.
- alltransclusions
- List all transclusions (pages embedded using {{x}}), including non-existing.
- backlinks
- Find all pages that link to the given page.
- categories
- List all categories the pages belong to.
- categorymembers
- List all pages in a given category.
- deletedrevisions
- Get deleted revision information.
- duplicatefiles
- List all files that are duplicates of the given files based on hash values.
- embeddedin
- Find all pages that embed (transclude) the given title.
- exturlusage
- Enumerate pages that contain a given URL.
- fileusage
- Find all pages that use the given files.
- images
- Returns all files contained on the given pages.
- imageusage
- Find all pages that use the given image title.
- iwbacklinks
- Find all pages that link to the given interwiki link.
- langbacklinks
- Find all pages that link to the given language link.
- links
- Returns all links from the given pages.
- linkshere
- Find all pages that link to the given pages.
- pageswithprop
- List all pages using a given page property.
- prefixsearch
- Perform a prefix search for page titles.
- protectedtitles
- List all titles protected from creation.
- querypage
- Get a list provided by a QueryPage-based special page.
- random
- Get a set of random pages.
- recentchanges
- Enumerate recent changes.
- redirects
- Returns all redirects to the given pages.
- revisions
- Get revision information.
- search
- Perform a full text search.
- templates
- Returns all pages transcluded on the given pages.
- trackingcategories
- Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
- transcludedin
- Find all pages that transclude the given pages.
- watchlist
- Get recent changes to pages in the current user's watchlist.
- watchlistraw
- Get all pages on the current user's watchlist.
- wblistentityusage
- Returns all pages that use the given entity IDs.
- wbsearch
- Internal. Searches for entities using labels and aliases.
- One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
- redirects
Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.
- Type: boolean (details)
- converttitles
Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.
- Type: boolean (details)
- token
A "watch" token retrieved from action=query&meta=tokens
- This parameter is required.
- Watch the page Main Page.
- api.php?action=watch&titles=Main%20Page&token=123ABC [open in sandbox]
- Watch the page Main Page with labels 1 and 2.
- api.php?action=watch&titles=Main%20Page&labels=1%7C2&token=123ABC [open in sandbox]
- Unwatch the page Main Page.
- api.php?action=watch&titles=Main%20Page&unwatch=&token=123ABC [open in sandbox]
- Watch the first few pages in the main namespace.
- api.php?action=watch&generator=allpages&gapnamespace=0&token=123ABC [open in sandbox]
action=wbavailablebadges
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Queries available badge items.
- Queries all available badge items
- api.php?action=wbavailablebadges [open in sandbox]
action=wbcreateclaim
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Creates Wikibase claims.
- entity
ID of the entity the claim is being added to
- This parameter is required.
- snaktype
The type of the snak
- This parameter is required.
- One of the following values: novalue, somevalue, value
- property
ID of the snaks property
- This parameter is required.
- value
Value of the snak when creating a claim with a snak that has a value
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Creates a claim for item Q999999998 of property P9001 with a "no value" snak.
- api.php?action=wbcreateclaim&entity=Q999999998&property=P9001&snaktype=novalue [open in sandbox]
- Creates a claim for item Q999999998 of property P9002 with string value "itsastring"
- api.php?action=wbcreateclaim&entity=Q999999998&property=P9002&snaktype=value&value="itsastring" [open in sandbox]
- Creates a claim for item Q999999998 of property P9003 with a value of item Q1
- api.php?action=wbcreateclaim&entity=Q999999998&property=P9003&snaktype=value&value={"entity-type":"item","numeric-id":1} [open in sandbox]
- Creates a claim for item Q999999998 of property P9004 with a coordinate snak value
- api.php?action=wbcreateclaim&entity=Q999999998&property=P9004&snaktype=value&value={"latitude":40.748433,"longitude":-73.985656,"globe":"http://www.wikidata.org/entity/Q2","precision":0.000001} [open in sandbox]
action=wbcreateredirect
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Creates Entity redirects.
- from
Entity ID to make a redirect
- This parameter is required.
- to
Entity ID to point the redirect to
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Turn Q999999998 into a redirect to Q999999999
- api.php?action=wbcreateredirect&from=Q999999998&to=Q999999999 [open in sandbox]
action=wbeditentity
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Creates a single new Wikibase entity and modifies it with serialised information.
- id
The identifier for the entity, including the prefix. Use either id or site and title together.
- new
If set, a new entity will be created. Set this to the type of the entity to be created. It is not allowed to have this set when id is also set.
- One of the following values: item, property
- site
An identifier for the site on which the page resides. Use together with title to make a complete sitelink.
- One of the following values:
- title
Title of the page to associate. Use together with site to make a complete sitelink.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- data
The serialized object that is used as the data source. A newly created entity will be assigned an 'id'.
- This parameter is required.
- clear
If set, the complete entity is emptied before proceeding. The entity will not be saved before it is filled with the "
data", possibly with parts excluded.- Type: boolean (details)
- Create a new empty item, return full entity structure
- api.php?action=wbeditentity&new=item&data={} [open in sandbox]
- Create a new item and set labels for de and en
- api.php?action=wbeditentity&new=item&data={"labels":{"de":{"language":"de","value":"de-value"},"en":{"language":"en","value":"en-value"}}} [open in sandbox]
- Create a new property containing the json data, return full entity structure
- api.php?action=wbeditentity&new=property&data={"labels":{"en-gb":{"language":"en-gb","value":"Propertylabel"}},"descriptions":{"en-gb":{"language":"en-gb","value":"Propertydescription"}},"datatype":"string"} [open in sandbox]
- Clear all data from entity with ID Q999999998
- api.php?action=wbeditentity&clear=true&id=Q999999998&data={} [open in sandbox]
- Clear all data from entity with ID Q999999998 and set a label for en
- api.php?action=wbeditentity&clear=true&id=Q999999998&data={"labels":{"en":{"language":"en","value":"en-value"}}} [open in sandbox]
- Adds a label without overwriting it if it already exists
- api.php?action=wbeditentity&id=Q999999998&data={"labels":[{"language":"no","value":"Bar","add":""}]} [open in sandbox]
- Removes a label
- api.php?action=wbeditentity&id=Q999999998&data={"labels":[{"language":"en","value":"Foo","remove":""}]} [open in sandbox]
- Sets sitelink for nowiki, overwriting it if it already exists
- api.php?action=wbeditentity&id=Q999999998&data={"sitelinks":{"nowiki":{"site":"nowiki","title":"København"}}} [open in sandbox]
- Sets description for nb, overwriting it if it already exists
- api.php?action=wbeditentity&id=Q999999998&data={"descriptions":{"nb":{"language":"nb","value":"nb-Description-Here"}}} [open in sandbox]
- Creates a new claim on the item for the property P56 and a value of "ExampleString"
- api.php?action=wbeditentity&id=Q999999998&data={"claims":[{"mainsnak":{"snaktype":"value","property":"P56","datavalue":{"value":"ExampleString","type":"string"}},"type":"statement","rank":"normal"}]} [open in sandbox]
- Removes the claims from the item with the provided GUIDs
- api.php?action=wbeditentity&id=Q999999998&data={"claims":[{"id":"Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F","remove":""},{"id":"Q999999998$GH678DSA-01PQ-28XC-HJ90-DDFD9990126X","remove":""}]} [open in sandbox]
- Sets the claim with the GUID to the value of the claim
- api.php?action=wbeditentity&id=Q999999998&data={"claims":[{"id":"Q999999998$GH678DSA-01PQ-28XC-HJ90-DDFD9990126X","mainsnak":{"snaktype":"value","property":"P56","datavalue":{"value":"ChangedString","type":"string"}},"type":"statement","rank":"normal"}]} [open in sandbox]
action=wbformatentities
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Formats entity IDs to HTML or plain text.
The language can be specified with the global uselang parameter.
- ids
The entity IDs to format.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- generate
The desired output format to generate.
- One of the following values: text/html, text/plain
- Default: text/html
- Format a single item ID to HTML.
- api.php?action=wbformatentities&ids=Q2 [open in sandbox]
- Format an item ID and a property ID.
- api.php?action=wbformatentities&ids=Q2|P2 [open in sandbox]
- Format three item IDs in French.
- api.php?action=wbformatentities&ids=Q2|Q3|Q4&uselang=fr [open in sandbox]
- Format three item IDs and a property ID to plain text.
- api.php?action=wbformatentities&ids=Q2|Q3|Q4|P2&generate=text/plain [open in sandbox]
action=wbformatvalue
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Formats DataValues.
- generate
The desired output format to generate.
- One of the following values: text/html, text/html; disposition=verbose, text/html; disposition=verbose-preview, text/plain, text/x-wiki
- Default: text/x-wiki
- datavalue
The data to format. This has to be the JSON serialization of a DataValue object.
- This parameter is required.
- datatype
The value's data type. This is distinct from the value's type
- One of the following values: commonsMedia, external-id, geo-shape, globe-coordinate, monolingualtext, quantity, string, tabular-data, time, url, wikibase-item, wikibase-property
- property
Property ID the data value belongs to, should be used instead of the datatype parameter.
- options
The options the formatter should use. Provided as a JSON object.
The supported options are:
- lang
- The language in which the value should be formatted (a MediaWiki language code).
- applyRounding
- Whether to apply rounding to the number. Can be a boolean (automatic / no rounding) or an integer (exponent of the last significant decimal digits). Only useful for quantity values.
- applyUnit
- Whether to include the unit in the output (a boolean). Only useful for quantity values.
- showcalendar
- Whether to show the calendar model. Can be a boolean (always / never show) or the string
"auto"(automatically determine whether to show). Only useful for time values.
- Format a simple string value.
- api.php?action=wbformatvalue&datavalue=%7B%22value%22%3A%22hello%22%2C%22type%22%3A%22string%22%7D [open in sandbox]
- Format a string value as a URL in HTML.
- api.php?action=wbformatvalue&datavalue=%7B%22value%22%3A%22http%3A%5C%2F%5C%2Facme.org%22%2C%22type%22%3A%22string%22%7D&datatype=url&generate=text%2Fhtml [open in sandbox]
- Format a time value as plain text, automatically showing the calendar model if needed.
- api.php?action=wbformatvalue&datavalue=%7B%22value%22%3A%7B%22time%22%3A%22%2B1879-03-14T00%3A00%3A00Z%22%2C%22timezone%22%3A0%2C%22before%22%3A0%2C%22after%22%3A0%2C%22precision%22%3A11%2C%22calendarmodel%22%3A%22http%3A%5C%2F%5C%2Fwww.wikidata.org%5C%2Fentity%5C%2FQ1985727%22%7D%2C%22type%22%3A%22time%22%7D&datatype=time&generate=text%2Fplain&options=%7B%22showcalendar%22%3A%22auto%22%7D [open in sandbox]
action=wbgetclaims
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Gets Wikibase claims.
- entity
ID of the entity from which to obtain claims. Required unless claim GUID is provided.
- property
Optional filter to only return claims with a main snak that has the specified property.
- claim
A GUID identifying the claim. Required unless entity is provided. The GUID is the globally unique identifier for a claim, e.g. "q42$D8404CDA-25E4-4334-AF13-A3290BCD9C0F".
- rank
Optional filter to return only the claims that have the specified rank
- One of the following values: deprecated, normal, preferred
- props
Some parts of the claim are returned optionally. This parameter controls which ones are returned.
- Values (separate with | or alternative): references
- Default: references
- Get claims for item with ID Q42
- api.php?action=wbgetclaims&entity=Q42 [open in sandbox]
- Get claims for item with ID Q42 and property with ID P31
- api.php?action=wbgetclaims&entity=Q42&property=P31 [open in sandbox]
- Get claims for item with ID Q42 that are ranked as normal
- api.php?action=wbgetclaims&entity=Q42&rank=normal [open in sandbox]
- Get claim with GUID of Q42$D8404CDA-25E4-4334-AF13-A3290BCD9C0F
- api.php?action=wbgetclaims&claim=Q42$D8404CDA-25E4-4334-AF13-A3290BCD9C0F [open in sandbox]
action=wbgetentities
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Gets the data for multiple Wikibase entities.
- ids
The IDs of the entities to get the data from
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- sites
Identifier for the site on which the corresponding page resides. Use together with
title, but only give one site for several titles or several sites for one title.- Values (separate with | or alternative):
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- titles
The title of the corresponding page. Use together with
sites, but only give one site for several titles or several sites for one title.- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- redirects
Whether redirects shall be resolved. If set to "no", redirects will be treated like deleted entities.
- One of the following values: no, yes
- Default: yes
- props
The names of the properties to get back from each entity. Will be further filtered by any languages given.
- Values (separate with | or alternative): aliases, claims, datatype, descriptions, info, labels, sitelinks, sitelinks/urls
- Default: info|sitelinks|aliases|labels|descriptions|claims|datatype
- languages
By default the internationalized values are returned in all available languages. This parameter allows filtering these down to one or more languages by providing one or more language codes.
- Values (separate with | or alternative): aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- languagefallback
Apply language fallback for languages defined in the languages parameter, with the current context of API call.
- Type: boolean (details)
- normalize
Try to normalize the page title against the client site. This only works if exactly one site and one page have been given.
- Type: boolean (details)
- sitefilter
Filter sitelinks in entities to those with these site IDs.
- Values (separate with | or alternative):
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- Get entities with ID Q42 with all available attributes in all available languages
- api.php?action=wbgetentities&ids=Q42 [open in sandbox]
- Get entities with ID P17 with all available attributes in all available languages
- api.php?action=wbgetentities&ids=P17 [open in sandbox]
- Get entities with IDs Q42 and P17 with all available attributes in all available languages
- api.php?action=wbgetentities&ids=Q42|P17 [open in sandbox]
- Get entities with ID Q42 with all available attributes in English language
- api.php?action=wbgetentities&ids=Q42&languages=en [open in sandbox]
- Get entities with ID Q42 with all available attributes in any possible fallback language for the ii language
- api.php?action=wbgetentities&ids=Q42&languages=ii&languagefallback= [open in sandbox]
- Get entities with ID Q42 showing all labels in all available languages
- api.php?action=wbgetentities&ids=Q42&props=labels [open in sandbox]
- Get entities with IDs P17 and P3 showing only datatypes
- api.php?action=wbgetentities&ids=P17|P3&props=datatype [open in sandbox]
- Get entities with ID Q42 showing all aliases in English language
- api.php?action=wbgetentities&ids=Q42&props=aliases&languages=en [open in sandbox]
- Get entities with IDs Q1 and Q42 showing descriptions in English, German and French languages
- api.php?action=wbgetentities&ids=Q1|Q42&props=descriptions&languages=en|de|fr [open in sandbox]
- Get the item for page "Berlin" on the site "enwiki", with language attributes in English language
- api.php?action=wbgetentities&sites=enwiki&titles=Berlin&languages=en [open in sandbox]
- Get the item for page "Berlin" on the site "enwiki" after normalizing the title from "berlin"
- api.php?action=wbgetentities&sites=enwiki&titles=berlin&normalize= [open in sandbox]
- Get the sitelinks for item Q42
- api.php?action=wbgetentities&ids=Q42&props=sitelinks [open in sandbox]
- Get entities with ID Q42 showing only sitelinks from "enwiki"
- api.php?action=wbgetentities&ids=Q42&sitefilter=enwiki [open in sandbox]
action=wblinktitles
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Associates two pages on two different wikis with a Wikibase item.
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- tosite
An identifier for the site on which the page resides. Use together with totitle to make a complete sitelink.
- This parameter is required.
- One of the following values:
- totitle
Title of the page to associate. Use together with tosite to make a complete sitelink.
- This parameter is required.
- fromsite
An identifier for the site on which the page resides. Use together with fromtitle to make a complete sitelink.
- This parameter is required.
- One of the following values:
- fromtitle
Title of the page to associate. Use together with fromsite to make a complete sitelink.
- This parameter is required.
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".
- Type: boolean (details)
- Add a link "Hydrogen" from the English page to "Wasserstoff" at the German page
- api.php?action=wblinktitles&fromsite=enwiki&fromtitle=Hydrogen&tosite=dewiki&totitle=Wasserstoff [open in sandbox]
action=wbmergeitems
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Merges multiple items.
- fromid
The ID to merge from
- This parameter is required.
- toid
The ID to merge to
- This parameter is required.
- ignoreconflicts
Array of elements of the item to ignore conflicts for. Can only contain values of "description", "sitelink" and "statement"
- Values (separate with | or alternative): description, sitelink, statement
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revisions.
- Values (separate with | or alternative):
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".
- Type: boolean (details)
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Merges data from Q999999998 into Q999999999
- api.php?action=wbmergeitems&fromid=Q999999998&toid=Q999999999 [open in sandbox]
- Merges data from Q999999998 into Q999999999 ignoring any conflicting sitelinks
- api.php?action=wbmergeitems&fromid=Q999999998&toid=Q999999999&ignoreconflicts=sitelink [open in sandbox]
- Merges data from Q999999998 into Q999999999 ignoring any conflicting sitelinks and descriptions
- api.php?action=wbmergeitems&fromid=Q999999998&toid=Q999999999&ignoreconflicts=sitelink|description [open in sandbox]
action=wbparsevalue
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Parses values using a ValueParser.
- datatype
Datatype of the value to parse. Determines the parser to use.
- One of the following values: commonsMedia, external-id, geo-shape, globe-coordinate, monolingualtext, quantity, string, tabular-data, time, url, wikibase-item, wikibase-property
- property
Property ID the value to parse belongs to. Determines the parser to use.
- parser
- Deprecated.
ID of the
ValueParserto use. Deprecated. Use the datatype parameter instead.- One of the following values: commonsMedia, external-id, geo-shape, globe-coordinate, globecoordinate, monolingualtext, null, quantity, string, tabular-data, time, url, wikibase-entityid, wikibase-item, wikibase-property
- values
The values to parse
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- options
The options the parser should use. Provided as a JSON object.
- validate
Whether to additionally verify the data passed in.
- Type: boolean (details)
- Parse a plain string into a StringValue object.
- api.php?action=wbparsevalue&datatype=string&values=foo|bar [open in sandbox]
- Parse 1994-02-08 to a TimeValue object with a precision of 9 (year).
- api.php?action=wbparsevalue&datatype=time&values=1994-02-08&options={"precision":9} [open in sandbox]
- Parse 1994-02-08 to a TimeValue object with a precision of 14 (second) with validation enabled, resulting in a validation failure.
- api.php?action=wbparsevalue&datatype=time&validate&values=1994-02-08&options={"precision":14} [open in sandbox]
- Parse foo into an object of whatever datatype P123 is, with validation enabled, potentially resulting in a validation failure depending on P123's datatype's expected input.
- api.php?action=wbparsevalue&property=P123&validate&values=foo [open in sandbox]
action=wbremoveclaims
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Removes Wikibase claims.
- claim
One GUID or several (pipe-separated) GUIDs identifying the claims to be removed. All claims must belong to the same entity.
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Remove claim with GUID of "Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0N"
- api.php?action=wbremoveclaims&claim=Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0N&token=foobar&baserevid=7201010 [open in sandbox]
action=wbremovequalifiers
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Removes a qualifier from a claim.
- claim
A GUID identifying the claim from which to remove qualifiers
- This parameter is required.
- qualifiers
Snak hashes of the qualifiers to remove
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Remove qualifier with hash "1eb8793c002b1d9820c833d234a1b54c8e94187e" from claim with GUID of "Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F"
- api.php?action=wbremovequalifiers&claim=Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F&qualifiers=1eb8793c002b1d9820c833d234a1b54c8e94187e&token=foobar&baserevid=7201010 [open in sandbox]
action=wbremovereferences
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Removes one or more references of the same statement.
- statement
A GUID identifying the statement for which a reference is being set
- This parameter is required.
- references
The hashes of the references that should be removed
- This parameter is required.
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Remove reference with hash "455481eeac76e6a8af71a6b493c073d54788e7e9" from the statement with GUID of "Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F"
- api.php?action=wbremovereferences&statement=Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F&references=455481eeac76e6a8af71a6b493c073d54788e7e9&token=foobar&baserevid=7201010 [open in sandbox]
action=wbsearchentities
- This module requires read rights.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Searches for entities using labels and aliases.
Returns a label and description for the entity in the user language if possible. Returns details of the matched term. The matched term text is also present in the aliases key if different from the display label.
- search
Search for this text.
- This parameter is required.
- language
Search in this language. This only affects how entities are selected, not the language in which the results are returned: this is controlled by the "uselang" parameter.
- This parameter is required.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- strictlanguage
Whether to disable language fallback
- Type: boolean (details)
- type
Search for this type of entity.
- One of the following values: item, item, property, property
- Default: item
- limit
Maximal number of results
- Type: integer or max
- The value must be between 0 and 50.
- Default: 7
- continue
Offset where to continue a search
- Type: integer
- The value must be between 0 and 10,000.
- Default: 0
- props
Return these properties for each entity.
- Values (separate with | or alternative): url
- Default: url
- profile
The search profile to use.
- default
- The default profile, suitable for most purposes.
- One of the following values: default
- Default: default
- Search for "abc" in English language, with defaults for type and limit
- api.php?action=wbsearchentities&search=abc&language=en [open in sandbox]
- Search for "abc" in English language with a limit of 50
- api.php?action=wbsearchentities&search=abc&language=en&limit=50 [open in sandbox]
- Search for "abc" in English language with a limit of 2 and an offset of 2
- api.php?action=wbsearchentities&search=abc&language=en&limit=2&continue=2 [open in sandbox]
- Search only properties for "alphabet" in English language
- api.php?action=wbsearchentities&search=alphabet&language=en&type=property [open in sandbox]
- Search for "alphabet" in English language omitting url parameter
- api.php?action=wbsearchentities&search=alphabet&language=en&props= [open in sandbox]
- Search for "Q1234" in English language, to match the entity ID.
- api.php?action=wbsearchentities&search=Q1234&language=en [open in sandbox]
action=wbsetaliases
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Sets the aliases for a Wikibase entity.
- id
The identifier for the entity, including the prefix. Use either id or site and title together.
- new
If set, a new entity will be created. Set this to the type of the entity you want to create.
- One of the following values: item, property
- site
An identifier for the site on which the page resides. Use together with title to make a complete sitelink.
- One of the following values:
- title
Title of the page to associate. Use together with site to make a complete sitelink.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- add
List of aliases to add (can be combined with remove)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- remove
List of aliases to remove (can be combined with add)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- set
A list of aliases that will replace the current list (cannot be combined with neither add nor remove)
- Separate values with | or alternative.
- Maximum number of values is 50 (500 for clients that are allowed higher limits).
- language
The language for which to set the aliases
- This parameter is required.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- Set the English aliases for the entity with ID Q999999998 to Foo and Bar
- api.php?action=wbsetaliases&language=en&id=Q999999998&set=Foo|Bar [open in sandbox]
- Add Foo and Bar to the list of English aliases for the entity with ID Q999999998
- api.php?action=wbsetaliases&language=en&id=Q999999998&add=Foo|Bar [open in sandbox]
- Remove Foo and Bar from the list of English aliases for the entity with ID Q999999998
- api.php?action=wbsetaliases&language=en&id=Q999999998&remove=Foo|Bar [open in sandbox]
- Remove Foo from the list of English aliases for the entity with ID Q999999998 while adding Bar to it
- api.php?action=wbsetaliases&language=en&id=Q999999998&remove=Foo&add=Bar [open in sandbox]
action=wbsetclaim
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Creates or updates an entire Statement or Claim.
- claim
Statement or Claim serialization
- This parameter is required.
- index
The index within the entity's list of statements to move the statement to. Optional. Be aware that when setting an index that specifies a position not next to a statement whose main snak does not feature the same property, the whole group of statements whose main snaks feature the same property is moved. When not provided, an existing statement will stay in place while a new statement will be appended to the last one whose main snak features the same property.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- ignoreduplicatemainsnak
If this is true, and the entity already has a claim with the same main snak as the claim being sent in the request, then the request is ignored
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Set the claim with the given ID to property P1 with a string value of "City"
- api.php?action=wbsetclaim&claim={"id":"Q999999998$5627445f-43cb-ed6d-3adb-760e85bd17ee","type":"claim","mainsnak":{"snaktype":"value","property":"P1","datavalue":{"value":"City","type":"string"}}} [open in sandbox]
- Set the claim with the given ID to property P1 with a string value of "City" and move the claim to the topmost position within the entity's subgroup of claims that feature the main snak property P1. In addition, move the whole subgroup to the top of all subgroups aggregated by property.
- api.php?action=wbsetclaim&claim={"id":"Q999999998$5627445f-43cb-ed6d-3adb-760e85bd17ee","type":"claim","mainsnak":{"snaktype":"value","property":"P1","datavalue":{"value":"City","type":"string"}}}&index=0 [open in sandbox]
- Set the Statement with the given ID to Property P1 with a string value of "City" and set the Statement's References to a single Reference featuring the string value "The Economy of Cities" assigned to the Property P2.
- api.php?action=wbsetclaim&claim={"id":"Q999999998$5627445f-43cb-ed6d-3adb-760e85bd17ee","type":"statement","mainsnak":{"snaktype":"value","property":"P1","datavalue":{"value":"City","type":"string"}},"references":[{"snaks":{"P2":[{"snaktype":"value","property":"P2","datavalue":{"value":"The Economy of Cities","type":"string"}}]},"snaks-order":["P2"]}],"rank":"normal"} [open in sandbox]
action=wbsetclaimvalue
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Sets the value of a Wikibase claim.
- claim
A GUID identifying the claim
- This parameter is required.
- value
The value to set the DataValue of the main snak of the claim to
- snaktype
The type of the snak
- This parameter is required.
- One of the following values: novalue, somevalue, value
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Sets the claim with the GUID of Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F to a value of Q1
- api.php?action=wbsetclaimvalue&claim=Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F&snaktype=value&value={"entity-type":"item","numeric-id":1}&token=foobar&baserevid=7201010 [open in sandbox]
action=wbsetdescription
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Sets a description for a single Wikibase entity.
- id
The identifier for the entity, including the prefix. Use either id or site and title together.
- new
If set, a new entity will be created. Set this to the type of the entity you want to create.
- One of the following values: item, property
- site
An identifier for the site on which the page resides. Use together with title to make a complete sitelink.
- One of the following values:
- title
Title of the page to associate. Use together with site to make a complete sitelink.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- language
Language of the description
- This parameter is required.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- value
The value to set for the description
- Set the string "An encyclopedia that everyone can edit" for page with ID "Q999999998" as a description in English language
- api.php?action=wbsetdescription&id=Q999999998&language=en&value=An%20encyclopedia%20that%20everyone%20can%20edit [open in sandbox]
- Set the string "An encyclopedia that everyone can edit" as a description in English language for page with a sitelink to enwiki:Wikipedia
- api.php?action=wbsetdescription&site=enwiki&title=Wikipedia&language=en&value=An%20encyclopedia%20that%20everyone%20can%20edit [open in sandbox]
action=wbsetlabel
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Sets a label for a single Wikibase entity.
- id
The identifier for the entity, including the prefix. Use either id or site and title together.
- new
If set, a new entity will be created. Set this to the type of the entity you want to create.
- One of the following values: item, property
- site
An identifier for the site on which the page resides. Use together with title to make a complete sitelink.
- One of the following values:
- title
Title of the page to associate. Use together with site to make a complete sitelink.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- language
Language of the label
- This parameter is required.
- One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
- value
The value of the label
- Set the string "Wikimedia" for page with ID "Q999999998" as a label in English language and report it as pretty printed JSON.
- api.php?action=wbsetlabel&id=Q999999998&language=en&value=Wikimedia&format=jsonfm [open in sandbox]
- Set the English language label to "Earth" for the item with sitelink enwiki => "Earth".
- api.php?action=wbsetlabel&site=enwiki&title=Earth&language=en&value=Earth [open in sandbox]
action=wbsetqualifier
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Creates a qualifier or sets the value of an existing one.
- claim
A GUID identifying the claim for which a qualifier is being set
- This parameter is required.
- property
ID of the snaks property. Should only be provided when creating a new qualifier or changing the property of an existing one
- value
The new value of the qualifier. Should only be provided for PropertyValueSnak qualifiers
- snaktype
The type of the snak. Should only be provided when creating a new qualifier or changing the type of an existing one
- One of the following values: novalue, somevalue, value
- snakhash
The hash of the snak to modify. Should only be provided for existing qualifiers
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Set the qualifier for the given claim with property P1 to string value GdyjxP8I6XB3
- api.php?action=wbsetqualifier&claim=Q999999998$4554c0f4-47b2-1cd9-2db9-aa270064c9f3&property=P1&value="GdyjxP8I6XB3"&snaktype=value&token=foobar [open in sandbox]
action=wbsetreference
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Creates a reference or sets the value of an existing one.
- statement
A GUID identifying the statement for which a reference is being set
- This parameter is required.
- snaks
The snaks to set the reference to. JSON object with property IDs pointing to arrays containing the snaks for that property
- This parameter is required.
- snaks-order
The order of the snaks. JSON array of property ID strings
- reference
A hash of the reference that should be updated. Optional. When not provided, a new reference is created
- index
The index within the statement's list of references where to move the reference to. Optional. When not provided, an existing reference will stay in place while a new reference will be appended.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- Create a new reference for claim with GUID Q999999998$D4FDE516-F20C-4154-ADCE-7C5B609DFDFF
- api.php?action=wbsetreference&statement=Q999999998$D4FDE516-F20C-4154-ADCE-7C5B609DFDFF&snaks={"P212":[{"snaktype":"value","property":"P212","datavalue":{"type":"string","value":"foo"}}]}&baserevid=7201010&token=foobar [open in sandbox]
- Set reference for claim with GUID Q999999998$D4FDE516-F20C-4154-ADCE-7C5B609DFDFF which has hash of 1eb8793c002b1d9820c833d234a1b54c8e94187e
- api.php?action=wbsetreference&statement=Q999999998$D4FDE516-F20C-4154-ADCE-7C5B609DFDFF&reference=1eb8793c002b1d9820c833d234a1b54c8e94187e&snaks={"P212":[{"snaktype":"value","property":"P212","datavalue":{"type":"string","value":"bar"}}]}&baserevid=7201010&token=foobar [open in sandbox]
- Creates a new reference for the claim with GUID Q999999998$D4FDE516-F20C-4154-ADCE-7C5B609DFDFF and inserts the new reference at the top of the list of references instead of appending it to the bottom.
- api.php?action=wbsetreference&statement=Q999999998$D4FDE516-F20C-4154-ADCE-7C5B609DFDFF&snaks={"P212":[{"snaktype":"novalue","property":"P212"}]}&index=0&baserevid=7201010&token=foobar [open in sandbox]
action=wbsetsitelink
- This module requires read rights.
- This module requires write rights.
- This module only accepts POST requests.
- Source: WikibaseClient
- License: GPL-2.0-or-later
Associates a page on a wiki with a Wikibase item or removes an already made such association.
- id
The identifier for the entity, including the prefix. Use either id or site and title together.
- new
If set, a new entity will be created. Set this to the type of the entity you want to create.
- One of the following values: item, property
- site
An identifier for the site on which the page resides. Use together with title to make a complete sitelink.
- One of the following values:
- title
Title of the page to associate. Use together with site to make a complete sitelink.
- baserevid
The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.
- Type: integer
- summary
Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.
Change tags to apply to the revision.
- Values (separate with | or alternative):
- token
A "csrf" token retrieved from action=query&meta=tokens
- This parameter is required.
- bot
Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".
- Type: boolean (details)
- returnto
Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.
- Type: page title
- Accepts non-existent pages.
- returntoquery
URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.
- Default: (empty)
- returntoanchor
URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.
- Default: (empty)
- linksite
The identifier of the site on which the page to link resides
- This parameter is required.
- One of the following values:
- linktitle
The title of the page to link. If this parameter is an empty string or both linktitle and badges are not set, the link will be removed.
- badges
The IDs of items to be set as badges. They will replace the current ones. If this parameter is not set, the badges will not be changed
- Values (separate with | or alternative):
- Add a sitelink to the English page "Hydrogen" to the item with ID Q999999998, if the sitelink does not exist
- api.php?action=wbsetsitelink&id=Q999999998&linksite=enwiki&linktitle=Hydrogen [open in sandbox]
- Add a sitelink to the English page "Hydrogen" to the item with ID Q999999998, if the sitelink does not exist. Also appends "Loves Oxygen" to the edit summary.
- api.php?action=wbsetsitelink&id=Q999999998&linksite=enwiki&linktitle=Hydrogen&summary=Loves%20Oxygen [open in sandbox]
- Add a sitelink to the German page "Wasserstoff" to the item that is linked with the English page "Hydrogen", if the sitelink does not exist
- api.php?action=wbsetsitelink&site=enwiki&title=Hydrogen&linksite=dewiki&linktitle=Wasserstoff [open in sandbox]
- Remove the German sitelink from the item
- api.php?action=wbsetsitelink&site=enwiki&title=Hydrogen&linksite=dewiki [open in sandbox]
- Add a sitelink to the Polish page "Wodór" to the item that is linked with the English page "Hydrogen", with one badge pointing to the item with ID "Q149"
- api.php?action=wbsetsitelink&site=enwiki&title=Hydrogen&linksite=plwiki&linktitle=Wodór&badges=Q149 [open in sandbox]
- Change badges for the link to the Polish page from the item with ID Q999999998 to two badges pointing to the items with IDs "Q2" and "Q149" without providing the link title
- api.php?action=wbsetsitelink&id=Q999999998&linksite=plwiki&badges=Q2|Q149 [open in sandbox]
- Change the link to the Polish page from the item with ID Q999999998 without changing badges
- api.php?action=wbsetsitelink&id=Q999999998&linksite=plwiki&linktitle=Warszawa [open in sandbox]
- Change the link to the Polish page from the item with ID Q999999998 and remove all of its badges
- api.php?action=wbsetsitelink&id=Q999999998&linksite=plwiki&linktitle=Wodór&badges= [open in sandbox]
action=webauthn
- This module requires read rights.
- Source: OATHAuth
- License: GPL-2.0-or-later AND GPL-3.0-or-later
API Module to communicate between server and client during registration/authentication process.
- func
Name of the requested function to be executed.
- getAuthInfo
- Authentication information.
- getRegisterInfo
- Registration information.
- register
- Register a new WebAuthn credential for the current user.
- This parameter is required.
- One of the following values: getAuthInfo, getRegisterInfo, register
- passkeyMode
Whether the key being registered is in passkey mode. (Only for getRegisterInfo.)
- Type: boolean (details)
- credential
JSON-encoded WebAuthn credential response from the browser.
- friendlyname
Friendly name for the new credential.
action=wikimediaeventsblockededit
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- Source: WikimediaEvents
- License: GPL-2.0-or-later
Log information about blocked edit attempts
- page
A page on which an edit attempt was made
- This parameter is required.
- interface
The interface which was used to edit
- This parameter is required.
- One of the following values: discussiontools, mobilefrontend, other, visualeditor, wikieditor
- platform
The platform which was used to edit
- This parameter is required.
- One of the following values: desktop, mobile
action=wikimediaeventshcaptchaeditattempt
- This module is internal or unstable, and you should not use it. Its operation may change without notice.
- This module requires read rights.
- This module only accepts POST requests.
- Source: WikimediaEvents
- License: GPL-2.0-or-later
Log edit diff when hCaptcha challenge is shown but edit is incomplete
- title
Page title
- This parameter is required.
- proposed_content
Proposed content text (max 8KB)
- This parameter is required.
- editing_session_id
Editing session ID
- This parameter is required.
- revision_id
Revision ID of the page being edited
- This parameter is required.
- Type: integer
format=json
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in JSON format.
- callback
If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.
- utf8
If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.
- Type: boolean (details)
- ascii
If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.
- Type: boolean (details)
- formatversion
Output formatting
- 1
- Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
- 2
- Modern format.
- latest
- Use the latest format (currently 2), may change without warning.
- One of the following values: 1, 2, latest
- Default: 1
- Return the query result in the JSON format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=json [open in sandbox]
format=jsonfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in JSON format (pretty-print in HTML).
- wrappedhtml
Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.
- Type: boolean (details)
- callback
If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.
- utf8
If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.
- Type: boolean (details)
- ascii
If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.
- Type: boolean (details)
- formatversion
Output formatting
- 1
- Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
- 2
- Modern format.
- latest
- Use the latest format (currently 2), may change without warning.
- One of the following values: 1, 2, latest
- Default: 1
- Return the query result in the JSON format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=jsonfm [open in sandbox]
format=none
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output nothing.
- Return the query result in the NONE format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=none [open in sandbox]
format=php
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in serialized PHP format.
- formatversion
Output formatting
- 1
- Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
- 2
- Modern format.
- latest
- Use the latest format (currently 2), may change without warning.
- One of the following values: 1, 2, latest
- Default: 1
- Return the query result in the PHP format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=php [open in sandbox]
format=phpfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in serialized PHP format (pretty-print in HTML).
- wrappedhtml
Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.
- Type: boolean (details)
- formatversion
Output formatting
- 1
- Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
- 2
- Modern format.
- latest
- Use the latest format (currently 2), may change without warning.
- One of the following values: 1, 2, latest
- Default: 1
- Return the query result in the PHP format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=phpfm [open in sandbox]
format=rawfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data, including debugging elements, in JSON format (pretty-print in HTML).
- wrappedhtml
Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.
- Type: boolean (details)
- Return the query result in the RAW format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=rawfm [open in sandbox]
format=xml
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in XML format.
- includexmlnamespace
If specified, adds an XML namespace.
- Type: boolean (details)
- Return the query result in the XML format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=xml [open in sandbox]
format=xmlfm
- This module requires read rights.
- Source: MediaWiki
- License: GPL-2.0-or-later
Output data in XML format (pretty-print in HTML).
- Return the query result in the XML format.
- api.php?action=query&meta=siteinfo&siprop=namespaces&format=xmlfm [open in sandbox]
Credits
API developers:
- Yuri Astrakhan (creator, lead developer Sep 2006–Sep 2007)
- Roan Kattouw (lead developer Sep 2007–2009)
- Victor Vasiliev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (lead developer 2013–2020)
Please send your comments, suggestions and questions to mediawiki-api@lists.wikimedia.org or file a bug report at https://phabricator.wikimedia.org/.