MediaWiki API help

This is an auto-generated MediaWiki Action API documentation page.

General information

Status: The MediaWiki API is a mature and stable interface that is actively supported and improved. While we try to avoid it, we may occasionally need to make breaking changes; subscribe to the mediawiki-api-announce mailing list for notice of updates.

Erroneous requests: When erroneous requests are sent to the API, an HTTP header will be sent with the key "MediaWiki-API-Error" and then both the value of the header and the error code sent back will be set to the same value. For more information see API: Errors and warnings.

Request methods

Action API requests may use GET and POST methods. Prefer using the GET method, which allows requests to be routed to faster replica servers and responses to be cached, unless the length of the URL with parameters would exceed its length limit (commonly 8000 bytes), or a module only accepts POST requests.

Parameters for POST requests may be sent in the query part of the request URL (like in GET requests) and in the POST request body, and mixing both ways in one request is allowed. Certain parameters such as passwords must be sent in the request body. If the same parameter is sent as part of the URL and also in the request body, it must have the same value in both places.

Data types

Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.

Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.

Some parameter types in API requests need further explanation:

boolean

Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.

expiry

Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.

timestamp

Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. The string now may be used to specify the current time.

Limits

Most API modules can accept up to 50 inputs in multivalue parameters, and can return up to 500 results per query (50 results for slow queries).

For users with the apihighlimits right (Bots and Administrators), the limits are increased to 500 inputs and 5,000 results (500 results for slow queries).

Templated parameters

Templated parameters support cases where an API module needs a value for each value of some other parameter. For example, if there were an API module to request fruit, it might have a parameter fruits to specify which fruits are being requested and a templated parameter {fruit}-quantity to specify how many of each fruit to request. An API client that wants 1 apple, 5 bananas, and 20 strawberries could then make a request like fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.

Main module

Specify the action to perform, the format of the response, and options that apply to all API modules.

Specific parameters:
action

Which action to perform. This parameter should be sent as part of the request URL (not the POST body) for ease of use in debugging, analytics, and request routing or filtering.

abusefiltercheckmatch
Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
abusefilterchecksyntax
Check syntax of an AbuseFilter filter.
abusefilterevalexpression
Evaluates an AbuseFilter expression.
abusefilterunblockautopromote
Unblocks a user from receiving autopromotions due to an abusefilter consequence.
abuselogprivatedetails
View private details of an AbuseLog entry.
acquiretempusername
Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
antispoof
Check a username against AntiSpoof's normalisation checks.
block
Block a user.
changeauthenticationdata
Change authentication data for the current user.
changecontentmodel
Change the content model of a page
checktoken
Check the validity of a token from action=query&meta=tokens.
clearhasmsg
Clears the hasmsg flag for the current user.
clientlogin
Log in to the wiki using the interactive flow.
compare
Get the difference between two pages.
createaccount
Create a new user account.
delete
Delete a page.
discussiontoolsedit
Post a message on a discussion page.
discussiontoolsfindcomment
Find a comment by its ID or name.
discussiontoolsgetsubscriptions
Get the subscription statuses of given topics.
discussiontoolssubscribe
Subscribe (or unsubscribe) to receive notifications about a topic.
discussiontoolsthank
Send a public thank-you notification for a comment.
echocreateevent
Manually trigger a notification to a user
echomarkread
Mark notifications as read for the current user.
echomarkseen
Mark notifications as seen for the current user.
echomute
Mute or unmute notifications from certain users or pages.
edit
Create and edit pages.
emailuser
Email a user.
expandtemplates
Expands all templates within wikitext.
feedcontributions
Returns a user's contributions feed.
feedrecentchanges
Returns a recent changes feed.
feedwatchlist
Returns a watchlist feed.
filerevert
Revert a file to an old version.
help
Display help for the specified modules.
imagerotate
Rotate one or more images.
import
Import a page from another wiki, or from an XML file.
languagesearch
Search for language names in any script.
linkaccount
Link an account from a third-party provider to the current user.
login
Log in and get authentication cookies.
logout
Log out and clear session data.
managetags
Perform management tasks relating to change tags.
mergehistory
Merge page histories.
move
Move a page.
opensearch
Search the wiki using the OpenSearch protocol.
options
Change preferences of the current user.
paraminfo
Obtain information about API modules.
parse
Parses content and returns parser output.
patrol
Patrol a page or revision.
protect
Change the protection level of a page.
purge
Purge the cache for the given titles.
query
Fetch data from and about MediaWiki.
removeauthenticationdata
Remove authentication data for the current user.
resetpassword
Send a password reset email to a user.
revisiondelete
Delete and undelete revisions.
rollback
Undo the last edit to the page.
rsd
Export an RSD (Really Simple Discovery) schema.
setnotificationtimestamp
Update the notification timestamp for watched pages.
setpagelanguage
Change the language of a page.
spamblacklist
Validate one or more URLs against the spam block list.
tag
Add or remove change tags from individual revisions or log entries.
templatedata
Fetch data stored by the TemplateData extension.
thank
Send a thank-you notification to an editor.
titleblacklist
Validate a page title, filename, or username against the TitleBlacklist.
unblock
Unblock a user.
undelete
Undelete revisions of a deleted page.
unlinkaccount
Remove a linked third-party account from the current user.
upload
Upload a file, or get the status of pending uploads.
userrights
Change a user's group membership.
validatepassword
Validate a password against the wiki's password policies.
watch
Add or remove pages from the current user's watchlist.
wbavailablebadges
Queries available badge items.
wbcreateclaim
Creates Wikibase claims.
wbcreateredirect
Creates Entity redirects.
wbeditentity
Creates a single new Wikibase entity and modifies it with serialised information.
wbformatentities
Formats entity IDs to HTML or plain text.
wbformatvalue
Formats DataValues.
wbgetclaims
Gets Wikibase claims.
wbgetentities
Gets the data for multiple Wikibase entities.
wblinktitles
Associates two pages on two different wikis with a Wikibase item.
wbmergeitems
Merges multiple items.
wbparsevalue
Parses values using a ValueParser.
wbremoveclaims
Removes Wikibase claims.
wbremovequalifiers
Removes a qualifier from a claim.
wbremovereferences
Removes one or more references of the same statement.
wbsearchentities
Searches for entities using labels and aliases.
wbsetaliases
Sets the aliases for a Wikibase entity.
wbsetclaim
Creates or updates an entire Statement or Claim.
wbsetclaimvalue
Sets the value of a Wikibase claim.
wbsetdescription
Sets a description for a single Wikibase entity.
wbsetlabel
Sets a label for a single Wikibase entity.
wbsetqualifier
Creates a qualifier or sets the value of an existing one.
wbsetreference
Creates a reference or sets the value of an existing one.
wbsetsitelink
Associates a page on a wiki with a Wikibase item or removes an already made such association.
webauthn
API Module to communicate between server and client during registration/authentication process.
categorytree
Internal. Internal module for the CategoryTree extension.
cirrus-check-sanity
Internal. Reports on the correctness of a range of page ids in the search index
cirrus-config-dump
Internal. Dump of CirrusSearch configuration.
cirrus-profiles-dump
Internal. Dump of CirrusSearch profiles for this wiki.
cirrus-schema-dump
Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
cspreport
Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
discussiontoolscompare
Internal. Get information about comment changes between two page revisions.
discussiontoolspageinfo
Internal. Returns metadata required to initialize the discussion tools.
discussiontoolspreview
Internal. Preview a message on a discussion page.
editcheckreferenceurl
Internal. Check the status of a URL for use as a reference.
scribunto-console
Internal. Internal module for servicing XHR requests from the Scribunto console.
stashedit
Internal. Prepare an edit in shared cache.
visualeditor
Internal. Returns HTML5 for a page from the Parsoid service.
visualeditoredit
Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
wikimediaeventsblockededit
Internal. Log information about blocked edit attempts
wikimediaeventshcaptchaeditattempt
Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, compare, createaccount, delete, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, emailuser, expandtemplates, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, help, imagerotate, import, languagesearch, linkaccount, login, logout, managetags, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setnotificationtimestamp, setpagelanguage, spamblacklist, tag, templatedata, thank, titleblacklist, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, wbavailablebadges, wbcreateclaim, wbcreateredirect, wbeditentity, wbformatentities, wbformatvalue, wbgetclaims, wbgetentities, wblinktitles, wbmergeitems, wbparsevalue, wbremoveclaims, wbremovequalifiers, wbremovereferences, wbsearchentities, wbsetaliases, wbsetclaim, wbsetclaimvalue, wbsetdescription, wbsetlabel, wbsetqualifier, wbsetreference, wbsetsitelink, webauthn, categorytree, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, cspreport, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, editcheckreferenceurl, scribunto-console, stashedit, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
Default: help
format

The format of the output.

json
Output data in JSON format.
jsonfm
Output data in JSON format (pretty-print in HTML).
none
Output nothing.
php
Output data in serialized PHP format.
phpfm
Output data in serialized PHP format (pretty-print in HTML).
rawfm
Output data, including debugging elements, in JSON format (pretty-print in HTML).
xml
Output data in XML format.
xmlfm
Output data in XML format (pretty-print in HTML).
One of the following values: json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
Default: jsonfm
maxlag

Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.

Type: integer
smaxage

Set the s-maxage HTTP cache control header to this many seconds. Errors are never cached.

Type: integer
The value must be no less than 0.
Default: 0
maxage

Set the max-age HTTP cache control header to this many seconds. Errors are never cached.

Type: integer
The value must be no less than 0.
Default: 0
assert

Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.

One of the following values: anon, bot, user
assertuser

Verify the current user is the named user.

Type: user, by any of username and Temporary user
requestid

Any value given here will be included in the response. May be used to distinguish requests.

servedby

Include the hostname that served the request in the results.

Type: boolean (details)
curtimestamp

Include the current timestamp in the result.

Type: boolean (details)
responselanginfo

Include the languages used for uselang and errorlang in the result.

Type: boolean (details)
origin

When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).

For authenticated requests, this must match one of the origins in the Origin header exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match the Origin header, a 403 response will be returned. If this parameter matches the Origin header and the origin is allowed, the Access-Control-Allow-Origin and Access-Control-Allow-Credentials headers will be set.

For non-authenticated requests, specify the value *. This will cause the Access-Control-Allow-Origin header to be set, but Access-Control-Allow-Credentials will be false and all user-specific data will be restricted.

crossorigin

When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of origin=* to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).

Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.

Type: boolean (details)
uselang

Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.

Default: user
variant

Variant of the language. Only works if the base language supports variant conversion.

errorformat

Format to use for warning and error text output

plaintext
Wikitext with HTML tags removed and entities replaced.
wikitext
Unparsed wikitext.
html
HTML
raw
Message key and parameters.
none
No text output, only the error codes.
bc
Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
One of the following values: bc, html, none, plaintext, raw, wikitext
Default: bc
errorlang

Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.

Default: uselang
errorsuselocal

If given, error texts will use locally-customized messages from the MediaWiki namespace.

Type: boolean (details)

action=abusefiltercheckmatch

Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.

vars, rcid or logid is required however only one may be used.

Specific parameters:
Other general parameters are available.
filter

The full filter text to check for a match.

This parameter is required.
vars

JSON encoded array of variables to test against.

rcid

Recent change ID to check against.

Type: integer
logid

Abuse filter log ID to check against.

Type: integer

action=abusefilterchecksyntax

Check syntax of an AbuseFilter filter.

Specific parameter:
Other general parameters are available.
filter

The full filter text to check syntax on.

This parameter is required.

action=abusefilterevalexpression

Evaluates an AbuseFilter expression.

Specific parameters:
Other general parameters are available.
expression

The expression to evaluate.

This parameter is required.
prettyprint

Whether the result should be pretty-printed.

Type: boolean (details)

action=abusefilterunblockautopromote

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Abuse Filter
  • License: GPL-2.0-or-later

Unblocks a user from receiving autopromotions due to an abusefilter consequence.

Specific parameters:
Other general parameters are available.
user

Username of the user you want to unblock.

This parameter is required.
Type: user, by username
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=abuselogprivatedetails

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Abuse Filter
  • License: GPL-2.0-or-later

View private details of an AbuseLog entry.

Specific parameters:
Other general parameters are available.
logid

The ID of the AbuseLog entry to be checked.

Type: integer
reason

A valid reason for performing the check.

Default: (empty)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Get private details for the AbuseLog entry with ID 1, using the reason "example".
api.php?action=abuselogprivatedetails&logid=1&reason=example&token=ABC123 [open in sandbox]

action=acquiretempusername

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.

If the user later performs an action that results in temp account creation, the stashed username will be used for their account. It may also be used in previews. However, the account is not created yet, and the name is not visible to other users.

action=antispoof

Check a username against AntiSpoof's normalisation checks.

Specific parameter:
Other general parameters are available.
username

The username to check against AntiSpoof.

This parameter is required.
Example:
Check username "Foo" against AntiSpoof
api.php?action=antispoof&username=Foo [open in sandbox]

action=block

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Block a user.

Specific parameters:
Other general parameters are available.
id

ID of the block to modify (obtained through list=blocks). Cannot be used together with user, reblock, or newblock.

Type: integer
user

User to block. Cannot be used together with id.

Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
userid
Deprecated.

Specify user=#ID instead.

Type: integer
expiry

Expiry time. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If set to infinite, indefinite, or never, the block will never expire.

Default: never
reason

Reason for block.

Default: (empty)
anononly

Block anonymous users only (i.e. disable anonymous edits for this IP address, including temporary account edits).

Type: boolean (details)
nocreate

Prevent account creation.

Type: boolean (details)
autoblock

Automatically block the last used IP address, and any subsequent IP addresses they try to login from.

Type: boolean (details)
noemail

Prevent user from sending email through the wiki. (Requires the blockemail right).

Type: boolean (details)
hidename

Hide the username from the block log. (Requires the hideuser right).

Type: boolean (details)
allowusertalk

Allow the user to edit their own talk page (depends on $wgBlockAllowsUTEdit).

Type: boolean (details)
reblock

If the user is already blocked by a single block, overwrite the existing block. If the user is blocked more than once, this will fail—use the id parameter instead to specify which block to overwrite. Cannot be used together with id or newblock.

Type: boolean (details)
newblock

Add another block even if the user is already blocked. Cannot be used together with id or reblock.

Type: boolean (details)
watchuser

Watch the user's or IP address's user and talk pages.

Type: boolean (details)
tags

Change tags to apply to the entry in the block log.

Values (separate with | or alternative):
partial

Block user from specific pages or namespaces rather than the entire site.

Type: boolean (details)
pagerestrictions

List of titles to block the user from editing. Only applies when partial is set to true.

Type: page title
Separate values with | or alternative.
Maximum number of values is 10.
Only accepts pages that exist.
namespacerestrictions

List of namespace IDs to block the user from editing. Only applies when partial is set to true.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
actionrestrictions

List of actions to block the user from performing. Only applies when partial is set to true.

Values (separate with | or alternative): create, move, thanks, upload
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Block IP address 192.0.2.5 for three days with a reason.
api.php?action=block&user=192.0.2.5&expiry=3%20days&reason=First%20strike&token=123ABC [open in sandbox]
Block user Vandal indefinitely with a reason, and prevent new account creation and email sending.
api.php?action=block&user=Vandal&expiry=never&reason=Vandalism&nocreate=&autoblock=&noemail=&token=123ABC [open in sandbox]

action=categorytree

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CategoryTree
  • License: GPL-2.0-or-later

Internal module for the CategoryTree extension.

Specific parameters:
Other general parameters are available.
category

Title in the category namespace, prefix will be ignored if given.

This parameter is required.
options

Options for the CategoryTree constructor as a JSON object. The depth option defaults to 1.

action=changeauthenticationdata (changeauth)

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change authentication data for the current user.

Specific parameters:
Other general parameters are available.
changeauthrequest

Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=change.

This parameter is required.
changeauthtoken

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=change (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.

action=changecontentmodel

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change the content model of a page

Specific parameters:
Other general parameters are available.
title

Title of the page to change the contentmodel of. Cannot be used together with pageid.

pageid

Page ID of the page to change the contentmodel of. Cannot be used together with title.

Type: integer
summary

Edit summary and log entry reason

tags

Change tags to apply to the log entry and edit.

Values (separate with | or alternative):
model

Content model of the new content.

This parameter is required.
One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, vue, wikitext
bot

Mark the content model change with a bot flag.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Change the main page to have the text content model
api.php?action=changecontentmodel&title=Main Page&model=text&token=123ABC [open in sandbox]

action=checktoken

Check the validity of a token from action=query&meta=tokens.

Specific parameters:
Other general parameters are available.
type

Type of token being tested.

This parameter is required.
One of the following values: createaccount, csrf, login, patrol, rollback, userrights, watch
token

Token to test.

This parameter is required.
maxtokenage

Maximum allowed age of the token, in seconds.

Type: integer

action=cirrus-check-sanity

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Reports on the correctness of a range of page ids in the search index

Specific parameters:
Other general parameters are available.
cluster

The search cluster to check indices in

This parameter is required.
One of the following values: default
from

Page id to start checking at

This parameter is required.
Type: integer
The value must be no less than 0.
limit

The number of page ids to check

Type: integer or max
The value must be between 1 and 500.
Default: 100
sequenceid

The number of times this set of page ids has been checked

Type: integer
rerenderfrequency

Number of checks after which a page should be rerendered. Based off the provided sequenceid.

Type: integer
The value must be no less than 2.
Default: 16

action=cirrus-config-dump

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of CirrusSearch configuration.

Specific parameter:
Other general parameters are available.
prop

Type of configuration variables to dump

Values (separate with | or alternative): expectedindices, globals, namespacemap, profiles, replicagroup, usertesting
Default: globals|namespacemap|profiles|replicagroup
Example:
Get a dump of CirrusSearch configuration.
api.php?action=cirrus-config-dump [open in sandbox]

action=cirrus-profiles-dump

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of CirrusSearch profiles for this wiki.

Specific parameter:
Other general parameters are available.
verbose

Dump the profiles content

Type: boolean (details)
Example:
Get a dump of CirrusSearch profiles for this wiki.
api.php?action=cirrus-profiles-dump [open in sandbox]

action=cirrus-schema-dump

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of CirrusSearch schema (settings and mappings) for this wiki.

Specific parameters:
Other general parameters are available.
build

Whether to build the schema from code (true) or fetch from live cluster (false).

Type: boolean (details)
plugins

List of OpenSearch/Elasticsearch plugins available on the target cluster. Only used when build=true. If not provided, plugins will be detected from the connected cluster.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Examples:
Get a dump of CirrusSearch schema from the live cluster.
api.php?action=cirrus-schema-dump [open in sandbox]
Generate CirrusSearch schema from code configuration.
api.php?action=cirrus-schema-dump&build=true [open in sandbox]
Generate CirrusSearch schema with specific plugins enabled.
api.php?action=cirrus-schema-dump&build=true&plugins=analysis-icu|extra-analysis-textify [open in sandbox]

action=clearhasmsg

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Clears the hasmsg flag for the current user.

Example:
Clear the hasmsg flag for the current user.
api.php?action=clearhasmsg [open in sandbox]

action=clientlogin (login)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Log in to the wiki using the interactive flow.

The general procedure to use this module is:

  1. Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=login, and a login token from action=query&meta=tokens.
  2. Present the fields to the user, and obtain their submission.
  3. Post to this module, supplying loginreturnurl and any relevant fields.
  4. Check the status in the response.
    • If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
    • If you received UI, present the new fields to the user and obtain their submission. Then post to this module with logincontinue and the relevant fields set, and repeat step 4.
    • If you received REDIRECT, direct the user to the redirecttarget and wait for the return to loginreturnurl. Then post to this module with logincontinue and any fields passed to the return URL, and repeat step 4.
    • If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
Specific parameters:
Other general parameters are available.
loginrequests

Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=login or from a previous response from this module.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
loginmessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
loginmergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
loginpreservestate

Preserve state from a previous failed login attempt, if possible.

Type: boolean (details)
loginreturnurl

Return URL for third-party authentication flows, must be absolute. Either this or logincontinue is required.

Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a logincontinue request to this API module.

logincontinue

This request is a continuation after an earlier UI or REDIRECT response. Either this or loginreturnurl is required.

Type: boolean (details)
logintoken

A "login" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=login (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.
Examples:
Start the process of logging in to the wiki as user Example with password ExamplePassword.
api.php?action=clientlogin&username=Example&password=ExamplePassword&loginreturnurl=http://example.org/&logintoken=123ABC [open in sandbox]
Continue logging in after a UI response for two-factor auth, supplying an OATHToken of 987654.
api.php?action=clientlogin&logincontinue=1&OATHToken=987654&logintoken=123ABC [open in sandbox]

action=compare

Get the difference between two pages.

A revision number, a page title, a page ID, text, or a relative reference for both "from" and "to" must be passed.

Specific parameters:
Other general parameters are available.
fromtitle

First title to compare.

fromid

First page ID to compare.

Type: integer
fromrev

First revision to compare.

Type: integer
fromslots

Override content of the revision specified by fromtitle, fromid or fromrev.

This parameter specifies the slots that are to be modified. Use fromtext-{slot}, fromcontentmodel-{slot}, and fromcontentformat-{slot} to specify content for each slot.

Values (separate with | or alternative): main
fromtext-{slot}

Text of the specified slot. If omitted, the slot is removed from the revision.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
fromsection-{slot}

When fromtext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by fromtitle, fromid or fromrev as if for a section edit.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
fromcontentformat-{slot}

Content serialization format of fromtext-{slot}.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
fromcontentmodel-{slot}

Content model of fromtext-{slot}. If not supplied, it will be guessed based on the other parameters.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of fromslots.
One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
frompst

Do a pre-save transform on fromtext-{slot}.

Type: boolean (details)
fromtext
Deprecated.

Specify fromslots=main and use fromtext-main instead.

fromcontentformat
Deprecated.

Specify fromslots=main and use fromcontentformat-main instead.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
fromcontentmodel
Deprecated.

Specify fromslots=main and use fromcontentmodel-main instead.

One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
fromsection
Deprecated.

Only use the specified section of the specified 'from' content.

totitle

Second title to compare.

toid

Second page ID to compare.

Type: integer
torev

Second revision to compare.

Type: integer
torelative

Use a revision relative to the revision determined from fromtitle, fromid or fromrev. All of the other 'to' options will be ignored.

One of the following values: cur, next, prev
toslots

Override content of the revision specified by totitle, toid or torev.

This parameter specifies the slots that are to be modified. Use totext-{slot}, tocontentmodel-{slot}, and tocontentformat-{slot} to specify content for each slot.

Values (separate with | or alternative): main
totext-{slot}

Text of the specified slot. If omitted, the slot is removed from the revision.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
tosection-{slot}

When totext-{slot} is the content of a single section, this is the section identifier. It will be merged into the revision specified by totitle, toid or torev as if for a section edit.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
tocontentformat-{slot}

Content serialization format of totext-{slot}.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
tocontentmodel-{slot}

Content model of totext-{slot}. If not supplied, it will be guessed based on the other parameters.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of toslots.
One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
topst

Do a pre-save transform on totext.

Type: boolean (details)
totext
Deprecated.

Specify toslots=main and use totext-main instead.

tocontentformat
Deprecated.

Specify toslots=main and use tocontentformat-main instead.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
tocontentmodel
Deprecated.

Specify toslots=main and use tocontentmodel-main instead.

One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
tosection
Deprecated.

Only use the specified section of the specified 'to' content.

prop

Which pieces of information to get.

diff
The diff HTML.
diffsize
The size of the diff HTML, in bytes.
rel
The revision IDs of the revision previous to 'from' and after 'to', if any.
ids
The page and revision IDs of the 'from' and 'to' revisions.
title
The page titles of the 'from' and 'to' revisions.
user
The username and ID of the 'from' and 'to' revisions. If the user has been revision deleted, a fromuserhidden or touserhidden property will be returned.
comment
The comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
parsedcomment
The parsed comment on the 'from' and 'to' revisions. If the comment has been revision deleted, a fromcommenthidden or tocommenthidden property will be returned.
size
The size of the 'from' and 'to' revisions.
timestamp
The timestamp of the 'from' and 'to' revisions.
Values (separate with | or alternative): comment, diff, diffsize, ids, parsedcomment, rel, size, timestamp, title, user
Default: diff|ids|title
slots

Return individual diffs for these slots, rather than one combined diff for all slots.

Values (separate with | or alternative): main
To specify all values, use *.
difftype

Return the comparison formatted as inline HTML.

One of the following values: table, unified
Default: table
Example:
Create a diff between revision 1 and 2.
api.php?action=compare&fromrev=1&torev=2 [open in sandbox]

action=createaccount (create)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Create a new user account.

The general procedure to use this module is:

  1. Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=create, and a createaccount token from action=query&meta=tokens.
  2. Present the fields to the user, and obtain their submission.
  3. Post to this module, supplying createreturnurl and any relevant fields.
  4. Check the status in the response.
    • If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
    • If you received UI, present the new fields to the user and obtain their submission. Then post to this module with createcontinue and the relevant fields set, and repeat step 4.
    • If you received REDIRECT, direct the user to the redirecttarget and wait for the return to createreturnurl. Then post to this module with createcontinue and any fields passed to the return URL, and repeat step 4.
    • If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
Specific parameters:
Other general parameters are available.
createrequests

Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=create or from a previous response from this module.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
createmessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
createmergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
createpreservestate

Preserve state from a previous failed login attempt, if possible.

If action=query&meta=authmanagerinfo returned true for hasprimarypreservedstate, requests marked as primary-required should be omitted. If it returned a non-empty value for preservedusername, that username must be used for the username parameter.

Type: boolean (details)
createreturnurl

Return URL for third-party authentication flows, must be absolute. Either this or createcontinue is required.

Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a createcontinue request to this API module.

createcontinue

This request is a continuation after an earlier UI or REDIRECT response. Either this or createreturnurl is required.

Type: boolean (details)
createtoken

A "createaccount" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=create (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.

action=cspreport

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.

Specific parameters:
Other general parameters are available.
reportonly

Mark as being a report from a monitoring policy, not an enforced policy

Type: boolean (details)
source

What generated the CSP header that triggered this report

Default: internal

action=delete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Delete a page.

Specific parameters:
Other general parameters are available.
title

Title of the page to delete. Cannot be used together with pageid.

pageid

Page ID of the page to delete. Cannot be used together with title.

Type: integer
reason

Reason for the deletion. If not set, an automatically generated reason will be used.

tags

Change tags to apply to the entry in the deletion log.

Values (separate with | or alternative):
deletetalk

Delete the talk page, if it exists.

Type: boolean (details)
watch
Deprecated.

Add the page to the current user's watchlist.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
unwatch
Deprecated.

Remove the page from the current user's watchlist.

Type: boolean (details)
oldimage

The name of the old image to delete as provided by action=query&prop=imageinfo&iiprop=archivename.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=discussiontoolscompare

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Get information about comment changes between two page revisions.

Specific parameters:
Other general parameters are available.
fromtitle

First title to compare.

fromrev

First revision to compare.

Type: integer
totitle

Second title to compare.

torev

Second revision to compare.

Type: integer

action=discussiontoolsedit

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Discussion tools
  • License: MIT

Post a message on a discussion page.

Specific parameters:
Other general parameters are available.
paction

Action to perform.

addcomment
Add a new comment as a reply to an existing comment.
addtopic
Add a new discussion section and the first comment in it.
This parameter is required.
One of the following values: addcomment, addtopic
autosubscribe

Automatically subscribe the user to the talk page thread?

One of the following values: default, no, yes
Default: default
page

The page to perform actions on.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
formtoken

An optional unique ID generated in the client to prevent double-posting.

Cannot be longer than 16 characters.
commentname

Name of the comment to reply to. Only used when paction is addcomment.

commentid

ID of the comment to reply to. Only used when paction is addcomment. Overrides commentname.

wikitext

Content to post, as wikitext. Cannot be used together with html.

html

Content to post, as HTML. Cannot be used together with wikitext.

summary

Edit summary.

sectiontitle

The title for a new section when using $1section=new. Only used when paction is addtopic.

allownosectiontitle

Allow posting a new section without a title.

Type: boolean (details)
useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

captchaid

Captcha ID (when saving with a captcha response).

captchaword

Answer to the captcha (when saving with a captcha response).

nocontent

Omit the HTML content of the new revision in the response.

tags

Change tags to apply to the edit.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)

action=discussiontoolsfindcomment

  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Find a comment by its ID or name.

Specific parameters:
Other general parameters are available.
idorname

Comment ID or name

heading

Heading hash fragment

page

Page that the heading hash fragment once existed on

action=discussiontoolsgetsubscriptions

  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Get the subscription statuses of given topics.

Specific parameter:
Other general parameters are available.
commentname

Names of the topics to check

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=discussiontoolspageinfo

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Returns metadata required to initialize the discussion tools.

Specific parameters:
Other general parameters are available.
page

The page to perform actions on.

oldid

The revision number to use (defaults to latest revision).

Type: integer
prop

Which properties to get:

transcludedfrom
Which other pages comments have been transcluded from
threaditemshtml
Representation of the comment threads parsed from the page
Values (separate with | or alternative): threaditemshtml, transcludedfrom
Default: transcludedfrom
threaditemsflags

Flags to alter the output when using prop=threaditemshtml.

noreplies
Don't include the full reply tree, just provide the top-level headings (when using prop=threaditemshtml).
activity
Include extra activity data about the oldest and latest replies (when using prop=threaditemshtml).
excludesignatures
Exclude user signatures from the comments (when using prop=threaditemshtml).
Values (separate with | or alternative): activity, excludesignatures, noreplies
excludesignatures
Deprecated.

Exclude user signatures from the comments (when using prop=threaditemshtml).

action=discussiontoolspreview

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: Discussion tools
  • License: MIT

Preview a message on a discussion page.

Specific parameters:
Other general parameters are available.
type

Type of message to preview

reply
Add a new comment as a reply to an existing comment.
topic
Add a new discussion section and the first comment in it.
This parameter is required.
One of the following values: reply, topic
page

The page to perform actions on.

This parameter is required.
wikitext

Content to preview, as wikitext.

This parameter is required.
sectiontitle

The title for a new section when using section=new.

useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022

action=discussiontoolssubscribe

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Discussion tools
  • License: MIT

Subscribe (or unsubscribe) to receive notifications about a topic.

Specific parameters:
Other general parameters are available.
page

A page on which the topic appears

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
commentname

Name of the topic to subscribe to (or unsubscribe from)

This parameter is required.
subscribe

True to subscribe, false to unsubscribe

This parameter is required.
Type: boolean (details)

action=discussiontoolsthank

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Discussion tools
  • License: MIT

Send a public thank-you notification for a comment.

Specific parameters:
Other general parameters are available.
page

The page to perform actions on.

This parameter is required.
commentid

ID of the comment to thank.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echocreateevent

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Manually trigger a notification to a user

Specific parameters:
Other general parameters are available.
user

User to send the notification to

Type: user, by any of username and user ID (e.g. "#12345")
header

Header content of the notification

This parameter is required.
Cannot be longer than 160 bytes.
content

Body content of the notification

This parameter is required.
Cannot be longer than 5,000 bytes.
page

Page to link to in the notification

Type: page title
Accepts non-existent pages.
section

Section where notification would be delivered

This parameter is required.
One of the following values: alert, notice
Default: notice
email

Whether to send an email as well

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echomarkread

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Mark notifications as read for the current user.

Specific parameters:
Other general parameters are available.
list

A list of notification IDs to mark as read.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
unreadlist

A list of notification IDs to mark as unread.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
all

If set, marks all of a user's notifications as read.

Type: boolean (details)
sections

A list of sections to mark as read.

Values (separate with | or alternative): alert, message
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=echomarkseen

  • This module requires read rights.
  • Source: Echo
  • License: MIT

Mark notifications as seen for the current user.

Specific parameters:
Other general parameters are available.
type

Type of notifications to mark as seen: 'alert', 'message' or 'all'.

This parameter is required.
One of the following values: alert, all, message
timestampFormat

Timestamp format to use for output, 'ISO_8601' or 'MW'. 'MW' is deprecated here, so all clients should switch to 'ISO_8601'. This parameter will be removed, and 'ISO_8601' will become the only output format.

One of the following values: ISO_8601, MW
Default: MW
Example:
Mark notifications of all types as seen
api.php?action=echomarkseen&type=all [open in sandbox]

action=echomute

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Echo
  • License: MIT

Mute or unmute notifications from certain users or pages.

Specific parameters:
Other general parameters are available.
type

Which mute list to add to or remove from

This parameter is required.
One of the following values: page-linked-title, user
mute

Pages or users to add to the mute list

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
unmute

Pages or users to remove from the mute list

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=edit

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Create and edit pages.

Specific parameters:
Other general parameters are available.
title

Title of the page to edit. Cannot be used together with pageid.

pageid

Page ID of the page to edit. Cannot be used together with title.

Type: integer
section

Section identifier. 0 for the top section, new for a new section. Often a positive integer, but can also be non-numeric.

sectiontitle

The title for a new section when using section=new.

text

Page content.

summary

Edit summary.

When this parameter is not provided or empty, an edit summary may be generated automatically.

When using section=new and sectiontitle is not provided, the value of this parameter is used for the section title instead, and an edit summary is generated automatically.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
minor

Mark this edit as a minor edit.

Type: boolean (details)
notminor

Do not mark this edit as a minor edit even if the "Mark all edits minor by default" user preference is set.

Type: boolean (details)
bot

Mark this edit as a bot edit.

Type: boolean (details)
baserevid

ID of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions. Self-conflicts cause the edit to fail unless basetimestamp is set.

Type: integer
basetimestamp

Timestamp of the base revision, used to detect edit conflicts. May be obtained through action=query&prop=revisions&rvprop=timestamp. Self-conflicts are ignored.

Type: timestamp (allowed formats)
starttimestamp

Timestamp when the editing process began, used to detect edit conflicts. An appropriate value may be obtained using curtimestamp when beginning the edit process (e.g. when loading the page content to edit).

Type: timestamp (allowed formats)
recreate

Override any errors about the page having been deleted in the meantime.

Type: boolean (details)
createonly

Don't edit the page if it already exists.

Type: boolean (details)
nocreate

Throw an error if the page doesn't exist.

Type: boolean (details)
watch
Deprecated.

Add the page to the current user's watchlist.

Type: boolean (details)
unwatch
Deprecated.

Remove the page from the current user's watchlist.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
md5

The MD5 hash of the text parameter, or the prependtext and appendtext parameters concatenated. If set, the edit won't be done unless the hash is correct.

prependtext

Add this text to the beginning of the page or section. Overrides text.

appendtext

Add this text to the end of the page or section. Overrides text.

Use section=new to append a new section, rather than this parameter.

undo

Undo this revision. Overrides text, prependtext and appendtext.

Type: integer
The value must be no less than 0.
undoafter

Undo all revisions from undo to this one. If not set, just undo one revision.

Type: integer
The value must be no less than 0.
redirect

Automatically resolve redirects.

Type: boolean (details)
contentformat

Content serialization format used for the input text.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
contentmodel

Content model of the new content.

One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
token

A "csrf" token retrieved from action=query&meta=tokens

The token should always be sent as the last parameter, or at least after the text parameter.

This parameter is required.
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
discussiontoolsautosubscribe

Automatically subscribe the user to any new talk page threads created by the edit. Use 'yes' or 'no' to override a user's preference (the default).

One of the following values: no, preferences, yes
Default: preferences
captchaword

Answer to the CAPTCHA

captchaid

CAPTCHA ID from previous request

action=editcheckreferenceurl

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: VisualEditor
  • License: MIT

Check the status of a URL for use as a reference.

Specific parameter:
Other general parameters are available.
url

URL to check.

This parameter is required.

action=emailuser

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Email a user.

Specific parameters:
Other general parameters are available.
target

User to send the email to.

This parameter is required.
subject

Subject header.

This parameter is required.
text

Email body.

This parameter is required.
ccme

Send a copy of this mail to me.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Send an email to the user WikiSysop with the text Content.
api.php?action=emailuser&target=WikiSysop&text=Content&token=123ABC [open in sandbox]

action=expandtemplates

Expands all templates within wikitext.

Specific parameters:
Other general parameters are available.
title

Title of the page.

text

Wikitext to convert.

This parameter is required.
revid

Revision ID, for {{REVISIONID}} and similar variables.

Type: integer
prop

Which pieces of information to get.

Note that if no values are selected, the result will contain the wikitext, but the output will be in a deprecated format.

wikitext
The expanded wikitext.
categories
Any categories present in the input that are not represented in the wikitext output.
properties
Page properties defined by expanded magic words in the wikitext.
volatile
Whether the output is volatile and should not be reused elsewhere within the page.
ttl
The maximum time after which caches of the result should be invalidated.
modules
Any ResourceLoader modules that parser functions have requested be added to the output. Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules.
jsconfigvars
Gives the JavaScript configuration variables specific to the page.
encodedjsconfigvars
Gives the JavaScript configuration variables specific to the page as a JSON string.
parsetree
The XML parse tree of the input.
Values (separate with | or alternative): categories, encodedjsconfigvars, jsconfigvars, modules, parsetree, properties, ttl, volatile, wikitext
includecomments

Whether to include HTML comments in the output.

Type: boolean (details)
showstrategykeys

Whether to include internal merge strategy information in jsconfigvars.

Type: boolean (details)
generatexml
Deprecated.

Generate XML parse tree (replaced by prop=parsetree).

Type: boolean (details)
Example:
Expand the wikitext {{Project:Sandbox}}.
api.php?action=expandtemplates&text={{Project:Sandbox}} [open in sandbox]

action=feedcontributions

Returns a user's contributions feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
user

What users to get the contributions for.

This parameter is required.
Type: user, by any of username, IP, Temporary user, IP range, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
namespace

Which namespace to filter the contributions by.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
year

From year (and earlier).

Type: integer
month

From month (and earlier).

Type: integer
tagfilter

Filter contributions that have these tags.

Values (separate with | or alternative): abusefilter-condition-limit, discussiontools, discussiontools-added-comment, discussiontools-edit, discussiontools-newtopic, discussiontools-reply, discussiontools-source, discussiontools-source-enhanced, discussiontools-visual, editcheck-newcontent, editcheck-newreference, editcheck-paste-shown, editcheck-reference-decline-common-knowledge, editcheck-reference-decline-irrelevant, editcheck-reference-decline-other, editcheck-reference-decline-uncertain, editcheck-references, editcheck-references-activated, editcheck-references-shown, editcheck-tone, editcheck-tone-shown, editsuggestion-seen, editsuggestion-used, mw-blank, mw-changed-redirect-target, mw-contentmodelchange, mw-edited-other-users-js, mw-ipblock-appeal, mw-manual-revert, mw-new-redirect, mw-recreated, mw-removed-redirect, mw-replace, mw-reverted, mw-rollback, mw-server-side-upload, mw-undo, nuke, replacetext, visualeditor, visualeditor-needcheck, visualeditor-switched, visualeditor-wikitext, wikieditor
Default: (empty)
deletedonly

Show only deleted contributions.

Type: boolean (details)
toponly

Only show edits that are the latest revisions.

Type: boolean (details)
newonly

Only show edits that are page creations.

Type: boolean (details)
hideminor

Hide minor edits.

Type: boolean (details)
showsizediff

Show the size difference between revisions.

Type: boolean (details)
Example:
Return contributions for user Example.
api.php?action=feedcontributions&user=Example [open in sandbox]

action=feedrecentchanges

Returns a recent changes feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
namespace

Namespace to limit the results to.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
invert

All namespaces but the selected one.

Type: boolean (details)
associated

Include associated (talk or main) namespace.

Type: boolean (details)
days

Days to limit the results to.

Type: integer
The value must be no less than 1.
Default: 7
limit

Maximum number of results to return.

Type: integer
The value must be between 1 and 50.
Default: 50
from

Show changes since then.

Type: timestamp (allowed formats)
hideminor

Hide minor changes.

Type: boolean (details)
hidebots

Hide changes made by bots.

Type: boolean (details)
hideanons

Hide changes made by anonymous users and temporary accounts.

Type: boolean (details)
hideliu

Hide changes made by registered users.

Type: boolean (details)
hidepatrolled

Hide patrolled changes.

Type: boolean (details)
hidemyself

Hide changes made by the current user.

Type: boolean (details)
hidecategorization

Hide category membership changes.

Type: boolean (details)
tagfilter

Filter by tag.

inverttags

All edits except ones tagged with the selected ones.

Type: boolean (details)
target

Show only changes on pages linked from this page.

showlinkedto

Show changes on pages linked to the selected page instead.

Type: boolean (details)

action=feedwatchlist

Returns a watchlist feed.

Specific parameters:
Other general parameters are available.
feedformat

The format of the feed.

One of the following values: atom, rss
Default: rss
hours

List pages modified within this many hours from now.

Type: integer
The value must be between 1 and 72.
Default: 24
linktosections

Link directly to changed sections if possible.

Type: boolean (details)
allrev

Include multiple revisions of the same page within given timeframe.

Type: boolean (details)
wlowner

Used along with token to access a different user's watchlist.

Type: user, by username
wltoken

A security token (available in the user's preferences) to allow access to another user's watchlist.

wlshow

Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set show=minor|!anon.

Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !unread, anon, autopatrolled, bot, minor, patrolled, unread
wltype

Which types of changes to show:

edit
Regular page edits.
new
Page creations.
log
Log entries.
external
External changes.
categorize
Category membership changes.
Values (separate with | or alternative): categorize, edit, external, log, new
Default: edit|new|log|categorize
wlexcludeuser

Don't list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
Examples:
Show the watchlist feed.
api.php?action=feedwatchlist [open in sandbox]
Show all changes to watched pages in the past 6 hours.
api.php?action=feedwatchlist&allrev=&hours=6 [open in sandbox]

action=filerevert

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Revert a file to an old version.

Specific parameters:
Other general parameters are available.
filename

Target filename, without the File: prefix.

This parameter is required.
comment

Upload comment.

Default: (empty)
archivename

Archive name of the revision to revert to.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=help

Display help for the specified modules.

Specific parameters:
Other general parameters are available.
modules

Modules to display help for (values of the action and format parameters, or main). Can specify submodules with a +.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: main
submodules

Include help for submodules of the named module.

Type: boolean (details)
recursivesubmodules

Include help for submodules recursively.

Type: boolean (details)
wrap

Wrap the output in a standard API response structure.

Type: boolean (details)
toc

Include a table of contents in the HTML output.

Type: boolean (details)

action=imagerotate

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Rotate one or more images.

Specific parameters:
Other general parameters are available.
rotation

Degrees to rotate image clockwise.

This parameter is required.
One of the following values: 90, 180, 270
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tags

Tags to apply to the entry in the upload log.

Values (separate with | or alternative):
titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsearch
Internal. Searches for entities using labels and aliases.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=import

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Import a page from another wiki, or from an XML file.

Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending a file for the xml parameter.

Specific parameters:
Other general parameters are available.
summary

Log entry import summary.

xml

Uploaded XML file.

Must be posted as a file upload using multipart/form-data.
interwikiprefix

For uploaded imports: interwiki prefix to apply to unknown usernames (and known users if assignknownusers is set).

interwikisource

For interwiki imports: wiki to import from.

One of the following values:
interwikipage

For interwiki imports: page to import.

fullhistory

For interwiki imports: import the full history, not just the current version.

Type: boolean (details)
templates

For interwiki imports: import all included templates as well.

Type: boolean (details)
namespace

Import to this namespace. Cannot be used together with rootpage.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
assignknownusers

Assign edits to local users where the named user exists locally.

Type: boolean (details)
rootpage

Import as subpage of this page. Cannot be used together with namespace.

tags

Change tags to apply to the entry in the import log and to the dummy revision on the imported pages.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=languagesearch

Search for language names in any script.

Specific parameters:
Other general parameters are available.
search

Search string.

This parameter is required.
typos

Number of spelling mistakes allowed in the search string.

Type: integer
Default: 1

action=linkaccount (link)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Link an account from a third-party provider to the current user.

The general procedure to use this module is:

  1. Fetch the fields available from action=query&meta=authmanagerinfo with amirequestsfor=link, and a csrf token from action=query&meta=tokens.
  2. Present the fields to the user, and obtain their submission.
  3. Post to this module, supplying linkreturnurl and any relevant fields.
  4. Check the status in the response.
    • If you received PASS or FAIL, you're done. The operation either succeeded or it didn't.
    • If you received UI, present the new fields to the user and obtain their submission. Then post to this module with linkcontinue and the relevant fields set, and repeat step 4.
    • If you received REDIRECT, direct the user to the redirecttarget and wait for the return to linkreturnurl. Then post to this module with linkcontinue and any fields passed to the return URL, and repeat step 4.
    • If you received RESTART, that means the authentication worked but we don't have a linked user account. You might treat this as UI or as FAIL.
Specific parameters:
Other general parameters are available.
linkrequests

Only use these authentication requests, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=link or from a previous response from this module.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
linkmessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
linkmergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
linkreturnurl

Return URL for third-party authentication flows, must be absolute. Either this or linkcontinue is required.

Upon receiving a REDIRECT response, you will typically open a browser or web view to the specified redirecttarget URL for a third-party authentication flow. When that completes, the third party will send the browser or web view to this URL. You should extract any query or POST parameters from the URL and pass them as a linkcontinue request to this API module.

linkcontinue

This request is a continuation after an earlier UI or REDIRECT response. Either this or linkreturnurl is required.

Type: boolean (details)
linktoken

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
*
This module accepts additional parameters depending on the available authentication requests. Use action=query&meta=authmanagerinfo with amirequestsfor=link (or a previous response from this module, if applicable) to determine the requests available and the fields that they use.

action=login (lg)

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Log in and get authentication cookies.

This action should only be used in combination with Special:BotPasswords; use for main-account login is deprecated and may fail without warning. To safely log in to the main account, use action=clientlogin.

Specific parameters:
Other general parameters are available.
lgname

Username.

lgpassword

Password.

lgdomain

Domain (optional).

lgtoken

A "login" token retrieved from action=query&meta=tokens

action=logout

  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Log out and clear session data.

Specific parameters:
Other general parameters are available.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
checkuserclienthints

Client hints data supplied alongside requests to ApiLogout. For internal use only.

Example:
Log the current user out.
api.php?action=logout&token=123ABC [open in sandbox]

action=managetags

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Perform management tasks relating to change tags.

Specific parameters:
Other general parameters are available.
operation

Which operation to perform:

create
Create a new change tag for manual use.
delete
Remove a change tag from the database, including removing the tag from all revisions, recent change entries and log entries on which it is used.
activate
Activate a change tag, allowing users to apply it manually.
deactivate
Deactivate a change tag, preventing users from applying it manually.
This parameter is required.
One of the following values: activate, create, deactivate, delete
tag

Tag to create, delete, activate or deactivate. For tag creation, the tag must not exist. For tag deletion, the tag must exist. For tag activation, the tag must exist and not be in use by an extension. For tag deactivation, the tag must be currently active and manually defined.

This parameter is required.
reason

An optional reason for creating, deleting, activating or deactivating the tag.

Default: (empty)
ignorewarnings

Whether to ignore any warnings that are issued during the operation.

Type: boolean (details)
tags

Change tags to apply to the entry in the tag management log.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=mergehistory

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Merge page histories.

Specific parameters:
Other general parameters are available.
from

Title of the page from which history will be merged. Cannot be used together with fromid.

fromid

Page ID of the page from which history will be merged. Cannot be used together with from.

Type: integer
to

Title of the page to which history will be merged. Cannot be used together with toid.

toid

Page ID of the page to which history will be merged. Cannot be used together with to.

Type: integer
timestamp

Timestamp up to which revisions will be moved from the source page's history to the destination page's history. If omitted, the entire page history of the source page will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.

reason

Reason for the history merge.

Default: (empty)
starttimestamp

Timestamp from which revisions will be moved from the source page's history to the destination page's history. If omitted, all revisions before the timestamp parameter (or the entire history if neither are specified) will be merged into the destination page. May specify "timestamp|revid" to split two revisions with the same timestamp.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=move

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Move a page.

Specific parameters:
Other general parameters are available.
from

Title of the page to rename. Cannot be used together with fromid.

fromid

Page ID of the page to rename. Cannot be used together with from.

Type: integer
to

Title to rename the page to.

This parameter is required.
reason

Reason for the rename.

Default: (empty)
movetalk

Rename the talk page, if it exists.

Type: boolean (details)
movesubpages

Rename subpages, if applicable.

Type: boolean (details)
noredirect

Don't create a redirect.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
ignorewarnings

Ignore any warnings.

Type: boolean (details)
tags

Change tags to apply to the entry in the move log and to the dummy revision on the destination page.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=opensearch

Search the wiki using the OpenSearch protocol.

Specific parameters:
Other general parameters are available.
search

Search string.

This parameter is required.
namespace

Namespaces to search. Ignored if search begins with a valid namespace prefix.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
Default: 0
limit

Maximum number of results to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
suggest
Deprecated.

No longer used.

Type: boolean (details)
redirects

How to handle redirects:

return
Return the redirect itself.
resolve
Return the target page. May return fewer than limit results.

For historical reasons, the default is "return" for format=json and "resolve" for other formats.

One of the following values: resolve, return
format

The format of the output.

One of the following values: json, jsonfm, xml, xmlfm
Default: json
warningsaserror

If warnings are raised with format=json, return an API error instead of ignoring them.

Type: boolean (details)
Example:
Find pages beginning with Te.
api.php?action=opensearch&search=Te [open in sandbox]

action=options

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change preferences of the current user.

Only options which are registered in core or in one of installed extensions, or options with keys prefixed with userjs- (intended to be used by user scripts), can be set.

Specific parameters:
Other general parameters are available.
reset

Resets preferences to the site defaults.

Type: boolean (details)
resetkinds

List of types of options to reset when the reset option is set.

Values (separate with | or alternative): all, registered, registered-checkmatrix, registered-multiselect, special, unused, userjs
Default: all
change

List of changes, formatted name=value (e.g. skin=vector). If no value is given (not even an equals sign), e.g., optionname|otheroption|..., the option will be reset to its default value. If any value passed contains the pipe character (|), use the alternative multiple-value separator for correct operation.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
optionname

The name of the option that should be set to the value given by optionvalue.

optionvalue

The value for the option specified by optionname. When optionname is set but optionvalue is omitted, the option will be reset to its default value.

global

What to do if the option was set globally using the GlobalPreferences extension.

  • ignore: Do nothing. The option remains with its previous value.
  • override: Add a local override.
  • update: Update the option globally.
  • create: Set the option globally, overriding any local value.
One of the following values: create, ignore, override, update
Default: ignore
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=paraminfo

Obtain information about API modules.

Specific parameters:
Other general parameters are available.
modules

List of module names (values of the action and format parameters, or main). Can specify submodules with a +, or all submodules with +*, or all submodules recursively with +**.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
helpformat

Format of help strings.

One of the following values: html, none, raw, wikitext
Default: none
querymodules
Deprecated.

List of query module names (value of prop, meta or list parameter). Use modules=query+foo instead of querymodules=foo.

Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allmessages, allpages, allredirects, allrevisions, alltransclusions, allusers, authmanagerinfo, backlinks, blocks, categories, categoryinfo, categorymembers, checkuser, checkuserformattedblockinfo, checkuserlog, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, codexicons, contributors, deletedrevisions, deletedrevs, description, duplicatefiles, embeddedin, entityterms, extlinks, extracts, exturlusage, filearchive, filerepoinfo, fileusage, gadgetcategories, gadgets, imageinfo, images, imageusage, info, iwbacklinks, iwlinks, langbacklinks, langlinks, languageinfo, links, linkshere, linterrors, linterstats, logevents, mystashedfiles, notifications, pageimages, pagepropnames, pageprops, pageswithprop, pageterms, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, siteinfo, stashimageinfo, tags, templates, tokens, trackingcategories, transcludedin, unreadnotificationpages, usercontribs, userinfo, users, watchlist, watchlistraw, wbcontentlanguages, wbentityusage, wblistentityusage, wbsearch, wbsubscribers, wikibase
Maximum number of values is 50 (500 for clients that are allowed higher limits).
mainmodule
Deprecated.

Get information about the main (top-level) module as well. Use modules=main instead.

pagesetmodule
Deprecated.

Get information about the pageset module (providing titles= and friends) as well.

formatmodules
Deprecated.

List of format module names (value of format parameter). Use modules instead.

Values (separate with | or alternative): json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm

action=parse

Parses content and returns parser output.

See the various prop-modules of action=query to get information from the current version of a page.

There are several ways to specify the text to parse:

  1. Specify a page or revision, using page, pageid, or oldid.
  2. Specify content explicitly, using text, title, revid, and contentmodel.
  3. Specify only a summary to parse. prop should be given an empty value.
Specific parameters:
Other general parameters are available.
title

Title of page the text belongs to. If omitted, contentmodel must be specified, and API will be used as the title.

text

Text to parse. Use title or contentmodel to control the content model.

revid

Revision ID, for {{REVISIONID}} and similar variables.

Type: integer
summary

Summary to parse.

page

Parse the content of this page. Cannot be used together with text and title.

pageid

Parse the content of this page. Overrides page.

Type: integer
redirects

If page or pageid is set to a redirect, resolve it.

Type: boolean (details)
oldid

Parse the content of this revision. Overrides page and pageid.

Type: integer
prop

Which pieces of information to get:

text
Gives the parsed text of the wikitext.
langlinks
Gives the language links in the parsed wikitext.
categories
Gives the categories in the parsed wikitext.
categorieshtml
Gives the HTML version of the categories.
links
Gives the internal links in the parsed wikitext.
templates
Gives the templates in the parsed wikitext.
images
Gives the images in the parsed wikitext.
externallinks
Gives the external links in the parsed wikitext.
sections
Deprecated. prop=sections has been deprecated. Please use prop=tocdata instead.
Gives the sections in the parsed wikitext.
tocdata
Gives the table of contents information in the parsed wikitext. See mw:API:Parsing_wikitext/TOCData for schema.
revid
Adds the revision ID of the parsed page.
displaytitle
Adds the title of the parsed wikitext.
subtitle
Adds the page subtitle for the parsed page.
headhtml
Gives parsed doctype, opening <html>, <head> element and opening <body> of the page.
modules
Gives the ResourceLoader modules used on the page. To load, use mw.loader.using(). Either jsconfigvars or encodedjsconfigvars must be requested jointly with modules.
jsconfigvars
Gives the JavaScript configuration variables specific to the page. To apply, use mw.config.set().
encodedjsconfigvars
Gives the JavaScript configuration variables specific to the page as a JSON string.
indicators
Gives the HTML of page status indicators used on the page.
iwlinks
Gives interwiki links in the parsed wikitext.
wikitext
Gives the original wikitext that was parsed.
properties
Gives various properties defined in the parsed wikitext.
limitreportdata
Gives the limit report in a structured way. Gives no data, when disablelimitreport is set.
limitreporthtml
Gives the HTML version of the limit report. Gives no data, when disablelimitreport is set.
parsetree
The XML parse tree of revision content (requires content model wikitext)
parsewarnings
Gives the warnings that occurred while parsing content (as wikitext).
parsewarningshtml
Gives the warnings that occurred while parsing content (as HTML).
headitems
Deprecated. prop=headitems is deprecated since MediaWiki 1.28. Use prop=headhtml when creating new HTML documents, or prop=modules|jsconfigvars when updating a document client-side.
Gives items to put in the <head> of the page.
Values (separate with | or alternative): categories, categorieshtml, displaytitle, encodedjsconfigvars, externallinks, headhtml, images, indicators, iwlinks, jsconfigvars, langlinks, limitreportdata, limitreporthtml, links, modules, parsetree, parsewarnings, parsewarningshtml, properties, revid, subtitle, templates, text, tocdata, wikitext, headitems, sections
Default: text|langlinks|categories|links|templates|images|externallinks|sections|tocdata|revid|displaytitle|iwlinks|properties|parsewarnings
wrapoutputclass

CSS class to use to wrap the parser output.

Default: mw-parser-output
usearticle

Use the ArticleParserOptions hook to ensure the options used match those used for article page views

Type: boolean (details)
parsoid
Deprecated.

Generate HTML conforming to the MediaWiki DOM spec using Parsoid. Replaced by parser=parsoid.

Type: boolean (details)
parser

Which wikitext parser to use:

parsoid
Generate HTML conforming to the MediaWiki DOM spec using Parsoid.
default
Generate HTML using this wiki's default parser.
legacy
Generate HTML using the legacy parser.
One of the following values: default, legacy, parsoid
Default: default
pst

Do a pre-save transform on the input before parsing it. Only valid when used with text.

Type: boolean (details)
onlypst

Do a pre-save transform (PST) on the input, but don't parse it. Returns the same wikitext, after a PST has been applied. Only valid when used with text.

Type: boolean (details)
effectivelanglinks
Deprecated.

Includes language links supplied by extensions (for use with prop=langlinks).

Type: boolean (details)
section

Only parse the content of the section with this identifier.

When new, parse text and sectiontitle as if adding a new section to the page.

new is allowed only when specifying text.

sectiontitle

New section title when section is new.

Unlike page editing, this does not fall back to summary when omitted or empty.

disablepp
Deprecated.

Use disablelimitreport instead.

Type: boolean (details)
disablelimitreport

Omit the limit report ("NewPP limit report") from the parser output.

Type: boolean (details)
disableeditsection

Omit edit section links from the parser output.

Type: boolean (details)
disablestylededuplication

Do not deduplicate inline stylesheets in the parser output.

Type: boolean (details)
showstrategykeys

Whether to include internal merge strategy information in jsconfigvars.

Type: boolean (details)
generatexml
Deprecated.

Generate XML parse tree (requires content model wikitext; replaced by prop=parsetree).

Type: boolean (details)
preview

Parse in preview mode.

Type: boolean (details)
sectionpreview

Parse in section preview mode (enables preview mode too).

Type: boolean (details)
disabletoc

Omit table of contents in output.

Type: boolean (details)
useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
contentformat

Content serialization format used for the input text. Only valid when used with text.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
contentmodel

Content model of the input text. If omitted, title must be specified, and default will be the model of the specified title. Only valid when used with text.

One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext

action=patrol

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Patrol a page or revision.

Specific parameters:
Other general parameters are available.
rcid

Recentchanges ID to patrol.

Type: integer
revid

Revision ID to patrol.

Type: integer
tags

Change tags to apply to the entry in the patrol log.

Values (separate with | or alternative):
token

A "patrol" token retrieved from action=query&meta=tokens

This parameter is required.

action=protect

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change the protection level of a page.

Specific parameters:
Other general parameters are available.
title

Title of the page to (un)protect. Cannot be used together with pageid.

pageid

ID of the page to (un)protect. Cannot be used together with title.

Type: integer
protections

List of protection levels, formatted action=level (e.g. edit=sysop). A level of all means everyone is allowed to take the action, i.e. no restriction.

Note: Any actions not listed will have restrictions removed.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
expiry

Expiry timestamps. If only one timestamp is set, it'll be used for all protections. Use infinite, indefinite, infinity, or never, for a never-expiring protection.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: infinite
reason

Reason for (un)protecting.

Default: (empty)
tags

Change tags to apply to the entry in the protection log.

Values (separate with | or alternative):
cascade

Enable cascading protection (i.e. protect transcluded templates and images used in this page). Ignored if none of the given protection levels support cascading.

Type: boolean (details)
watch
Deprecated.

If set, add the page being (un)protected to the current user's watchlist.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=purge

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Purge the cache for the given titles.

Specific parameters:
Other general parameters are available.
forcelinkupdate

Update the links tables and do other secondary data updates.

Type: boolean (details)
forcerecursivelinkupdate

Same as forcelinkupdate, and update the links tables for any page that uses this page as a template.

Type: boolean (details)
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsearch
Internal. Searches for entities using labels and aliases.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)

action=query

Fetch data from and about MediaWiki.

All data modifications will first have to use query to acquire a token to prevent abuse from malicious sites.

Specific parameters:
Other general parameters are available.
prop

Which properties to get for the queried pages.

categories
List all categories the pages belong to.
categoryinfo
Returns information about the given categories.
contributors
Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
entityterms
Get the terms (labels, descriptions and aliases) of the entity on this page.
extlinks
Returns all external URLs (not interwikis) from the given pages.
extracts
Returns plain-text or limited HTML extracts of the given pages.
fileusage
Find all pages that use the given files.
imageinfo
Returns file information and upload history.
images
Returns all files contained on the given pages.
info
Get basic page information.
iwlinks
Returns all interwiki links from the given pages.
langlinks
Returns all interlanguage links from the given pages.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageimages
Returns information about images on the page, such as thumbnail and presence of photos.
pageprops
Get various page properties defined in the page content.
pageterms
Get the MonoCloud Wiki terms (typically labels, descriptions and aliases) associated with a page via a sitelink.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
stashimageinfo
Returns file information for stashed files.
templates
Returns all pages transcluded on the given pages.
transcludedin
Find all pages that transclude the given pages.
wbentityusage
Returns all entity IDs used in the given pages.
cirrusbuilddoc
Internal. Dump of a CirrusSearch article document from the database servers
cirruscompsuggestbuilddoc
Internal. Dump of the document used by the completion suggester
cirrusdoc
Internal. Dump of a CirrusSearch article document from the search servers
description
Internal. Get a short description a.k.a. subtitle explaining what the target page is about.
Values (separate with | or alternative): categories, categoryinfo, contributors, deletedrevisions, duplicatefiles, entityterms, extlinks, extracts, fileusage, imageinfo, images, info, iwlinks, langlinks, links, linkshere, pageimages, pageprops, pageterms, redirects, revisions, stashimageinfo, templates, transcludedin, wbentityusage, cirrusbuilddoc, cirruscompsuggestbuilddoc, cirrusdoc, description
list

Which lists to get.

abusefilters
Show details of the abuse filters.
abuselog
Show events that were caught by one of the abuse filters.
allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
allusers
Enumerate all registered users.
backlinks
Find all pages that link to the given page.
blocks
List all blocked users and IP addresses.
categorymembers
List all pages in a given category.
checkuserlog
Get entries from the CheckUser log.
codexicons
Get Codex icons
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
filearchive
Enumerate all deleted files sequentially.
gadgetcategories
Returns a list of gadget sections.
gadgets
Returns a list of gadgets used on this wiki.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
linterrors
Get a list of lint errors
logevents
Get events from logs.
mystashedfiles
Get a list of files in the current user's upload stash.
pagepropnames
List all page property names in use on the wiki.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
search
Perform a full text search.
tags
List change tags.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
usercontribs
Get all edits by a user.
users
Get information about a list of users.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsubscribers
Get subscriptions to given entities.
checkuser
Deprecated. This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.
deletedrevs
Deprecated. list=deletedrevs has been deprecated. Please use prop=deletedrevisions or list=alldeletedrevisions instead.
List deleted revisions.
wbsearch
Internal. Searches for entities using labels and aliases.
Values (separate with | or alternative): abusefilters, abuselog, allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, allusers, backlinks, blocks, categorymembers, checkuserlog, codexicons, embeddedin, exturlusage, filearchive, gadgetcategories, gadgets, imageusage, iwbacklinks, langbacklinks, linterrors, logevents, mystashedfiles, pagepropnames, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, search, tags, trackingcategories, usercontribs, users, watchlist, watchlistraw, wblistentityusage, wbsubscribers, checkuser, deletedrevs, wbsearch
meta

Which metadata to get.

allmessages
Return messages from this site.
authmanagerinfo
Retrieve information about the current authentication status.
filerepoinfo
Return meta information about image repositories configured on the wiki.
languageinfo
Return information about available languages.
linterstats
Get number of lint errors in each category
notifications
Get notifications waiting for the current user.
siteinfo
Return general information about the site.
tokens
Gets tokens for data-modifying actions.
unreadnotificationpages
Get pages for which there are unread notifications for the current user.
userinfo
Get information about the current user.
wbcontentlanguages
Returns information about the content languages Wikibase accepts in different contexts.
wikibase
Get information about the Wikibase client and the associated Wikibase repository.
checkuserformattedblockinfo
Internal. Return formatted block details for sitewide blocks affecting the current user.
Values (separate with | or alternative): allmessages, authmanagerinfo, filerepoinfo, languageinfo, linterstats, notifications, siteinfo, tokens, unreadnotificationpages, userinfo, wbcontentlanguages, wikibase, checkuserformattedblockinfo
indexpageids

Include an additional pageids section listing all returned page IDs.

Type: boolean (details)
export

Export the current revisions of all given or generated pages.

Type: boolean (details)
exportnowrap

Return the export XML without wrapping it in an XML result (same format as Special:Export). Can only be used with query+export.

Type: boolean (details)
exportschema

Target the given version of the XML dump format when exporting. Can only be used with query+export.

One of the following values: 0.10, 0.11
Default: 0.11
iwurl

Whether to get the full URL if the title is an interwiki link.

Type: boolean (details)
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

rawcontinue

Return raw query-continue data for continuation.

Type: boolean (details)
titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsearch
Internal. Searches for entities using labels and aliases.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
redirects

Automatically resolve redirects in query+titles, query+pageids, and query+revids, and in pages returned by query+generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)

prop=categories (cl)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all categories the pages belong to.

Specific parameters:
Other general parameters are available.
clprop

Which additional properties to get for each category:

sortkey
Adds the sortkey (hexadecimal string) and sortkey prefix (human-readable part) for the category.
timestamp
Adds timestamp of when the category was added.
hidden
Tags categories that are hidden with __HIDDENCAT__.
Values (separate with | or alternative): hidden, sortkey, timestamp
clshow

Which kind of categories to show.

Values (separate with | or alternative): !hidden, hidden
cllimit

How many categories to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
clcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

clcategories

Only list these categories. Useful for checking whether a certain page is in a certain category.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
cldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
Get a list of categories the page Albert Einstein belongs to.
api.php?action=query&prop=categories&titles=Albert%20Einstein [open in sandbox]
Get information about all categories used in the page Albert Einstein.
api.php?action=query&generator=categories&titles=Albert%20Einstein&prop=info [open in sandbox]

prop=categoryinfo (ci)

Returns information about the given categories.

Specific parameter:
Other general parameters are available.
cicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Get information about Category:Foo and Category:Bar.
api.php?action=query&prop=categoryinfo&titles=Category:Foo|Category:Bar [open in sandbox]

prop=cirrusbuilddoc (cb)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of a CirrusSearch article document from the database servers

Specific parameters:
Other general parameters are available.
cbbuilders

Type of data to extract

Values (separate with | or alternative): content, links
Default: content|links
cblimiterprofile

Profile to use when limiting the size of the document

Example:
Get a dump of a single CirrusSearch article generated from the database.
api.php?action=query&prop=cirrusbuilddoc&titles=Main_Page [open in sandbox]

prop=cirruscompsuggestbuilddoc (csb)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of the document used by the completion suggester

Specific parameter:
Other general parameters are available.
csbmethod

Provide a score method name to be used by the completion suggester

Default: quality

prop=cirrusdoc (cd)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CirrusSearch
  • License: GPL-2.0-or-later

Dump of a CirrusSearch article document from the search servers

Specific parameter:
Other general parameters are available.
cdincludes

Define which fields should be returned by the search.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: all
Examples:
Get a dump of a single CirrusSearch article as currently indexed into search.
api.php?action=query&prop=cirrusdoc&titles=Main_Page [open in sandbox]
Get a dump of CirrusSearch settings for this wiki with just the Categories that have been selected using the 'includes' parameter
api.php?action=query&prop=cirrusdoc&titles=Main_Page&cdincludes=category [open in sandbox]

prop=contributors (pc)

Get the list of registered contributors (including temporary users) and the count of anonymous contributors to a page.

Specific parameters:
Other general parameters are available.
pcgroup

Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
pcexcludegroup

Exclude users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
pcrights

Only include users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, bigdelete, block, blockemail, bot, browsearchive, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, createaccount, createpage, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editcontentmodel, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, editusercss, edituserjs, edituserjson, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, item-merge, item-redirect, item-term, logentryimport, manage-all-push-subscriptions, managechangetags, markbotedits, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, patrol, patrolmarks, property-create, property-term, protect, read, renameuser, renameuser-global, replacetext, reupload, reupload-own, reupload-shared, rollback, sboverride, sendemail, siteadmin, skipcaptcha, spamblacklistlog, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, titleblacklistlog, unblockself, undelete, unwatchedpages, upload, upload_by_url, userrights, userrights-interwiki, viewmyprivateinfo, viewmywatchlist, viewsuppressed
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pcexcluderights

Exclude users having the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, bigdelete, block, blockemail, bot, browsearchive, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, createaccount, createpage, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, echo-create, echo-read-notifications, edit, editcontentmodel, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, editusercss, edituserjs, edituserjson, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, item-merge, item-redirect, item-term, logentryimport, manage-all-push-subscriptions, managechangetags, markbotedits, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, patrol, patrolmarks, property-create, property-term, protect, read, renameuser, renameuser-global, replacetext, reupload, reupload-own, reupload-shared, rollback, sboverride, sendemail, siteadmin, skipcaptcha, spamblacklistlog, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, titleblacklistlog, unblockself, undelete, unwatchedpages, upload, upload_by_url, userrights, userrights-interwiki, viewmyprivateinfo, viewmywatchlist, viewsuppressed
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pclimit

How many contributors to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
pccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=deletedrevisions (drv)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get deleted revision information.

May be used in several ways:

  1. Get deleted revisions for a set of pages, by setting titles or pageids. Ordered by title and timestamp.
  2. Get data about a set of deleted revisions by setting their IDs with revids. Ordered by revision ID.
Specific parameters:
Other general parameters are available.
drvprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, drvlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, drvlimit is enforced to 50.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
drvslots

Which revision slots to return data for, when slot-related properties are included in drvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
drvcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of drvslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
drvlimit

Limit how many revisions will be returned. If drvprop=content, drvprop=parsetree, drvdiffto or drvdifftotext is used, the limit is 50. If drvparse is used, the limit is 1.

Type: integer or max
The value must be between 1 and 500.
drvexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires drvprop=content).

Type: boolean (details)
drvgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires drvprop=content).

Type: boolean (details)
drvparse
Deprecated.

Use action=parse instead. Parse revision content (requires drvprop=content). For performance reasons, if this option is used, drvlimit is enforced to 1.

Type: boolean (details)
drvsection

Only retrieve the content of the section with this identifier.

drvdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, drvlimit is enforced to 50.

drvdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides drvdiffto. If drvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, drvlimit is enforced to 50.

drvdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with drvdifftotext.

Type: boolean (details)
drvcontentformat
Deprecated.

Serialization format used for drvdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
drvstart

The timestamp to start enumerating from. Ignored when processing a list of revision IDs.

Type: timestamp (allowed formats)
drvend

The timestamp to stop enumerating at. Ignored when processing a list of revision IDs.

Type: timestamp (allowed formats)
drvdir

In which direction to enumerate:

newer
List oldest first. Note: drvstart has to be before drvend.
older
List newest first (default). Note: drvstart has to be later than drvend.
One of the following values: newer, older
Default: older
drvtag

Only list revisions tagged with this tag.

drvuser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drvexcludeuser

Don't list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drvcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=description (desc)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get a short description a.k.a. subtitle explaining what the target page is about.

The description is plain text, on a single line, but otherwise arbitrary (potentially including raw HTML tags, which also should be interpreted as plain text). It must not be used in HTML unescaped!

Specific parameters:
Other general parameters are available.
desccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
Default: 0
descprefersource

Which description source to prefer if present:

local
Local descriptions via {{SHORTDESC:...}} parser function in the wikitext of the page.
central
Central descriptions from the associated MonoCloud Wiki item.
One of the following values: central, local
Default: local
Examples:
Get the description for the page 'London'.
api.php?action=query&prop=description&titles=London [open in sandbox]
Get the description for the page 'London', preferring the central description if it exists.
api.php?action=query&prop=description&titles=London&descprefersource=central [open in sandbox]

prop=duplicatefiles (df)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all files that are duplicates of the given files based on hash values.

Specific parameters:
Other general parameters are available.
dflimit

How many duplicate files to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
dfcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

dfdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
dflocalonly

Look only for files in the local repository.

Type: boolean (details)

prop=entityterms (wbet)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get the terms (labels, descriptions and aliases) of the entity on this page.

Specific parameters:
Other general parameters are available.
wbetcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
wbetlanguage

The language code to get terms in. If not specified, the user language is used.

One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uselang, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
Default: uselang
wbetterms

The types of terms to get, e.g. 'description', each returned as an array of strings keyed by their type, e.g. {"description": ["foo"]}. If not specified, all types are returned.

Values (separate with | or alternative): alias, description, label
Default: alias|label|description
Example:
Get labels and aliases of item Q84.
api.php?action=query&prop=entityterms&titles=Q84 [open in sandbox]

Returns all external URLs (not interwikis) from the given pages.

Specific parameters:
Other general parameters are available.
ellimit

How many links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
elcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

elprotocol

Protocol of the URL. If empty and elquery is set, the protocol is http and https. Leave both this and elquery empty to list all external links.

One of the following values: Can be empty, or bitcoin, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
Default: (empty)
elquery

Search string without protocol. Useful for checking whether a certain page contains a certain external url.

elexpandurl
Deprecated.

Expand protocol-relative URLs with the canonical protocol.

Type: boolean (details)

prop=extracts (ex)

Returns plain-text or limited HTML extracts of the given pages.

Specific parameters:
Other general parameters are available.
exchars

How many characters to return. Actual text returned might be slightly longer.

Type: integer
The value must be between 1 and 1,200.
exsentences

How many sentences to return.

Type: integer
The value must be between 1 and 10.
exlimit

How many extracts to return. (Multiple extracts can only be returned if exintro is set to true.)

Type: integer or max
The value must be between 1 and 20.
Default: 20
exintro

Return only content before the first section.

Type: boolean (details)
explaintext

Return extracts as plain text instead of limited HTML.

Type: boolean (details)
exsectionformat

How to format sections in plaintext mode:

plain
No formatting.
wiki
Wikitext-style formatting (== like this ==).
raw
This module's internal representation (section titles prefixed with <ASCII 1><ASCII 2><section level><ASCII 2><ASCII 1>).
One of the following values: plain, raw, wiki
Default: wiki
excontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer

prop=fileusage (fu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that use the given files.

Specific parameters:
Other general parameters are available.
fuprop

Which properties to get:

pageid
Page ID of each page.
title
Title of each page.
redirect
Flag if the page is a redirect.
Values (separate with | or alternative): pageid, redirect, title
Default: pageid|title|redirect
funamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
fushow

Show only items that meet these criteria:

redirect
Only show redirects.
!redirect
Only show non-redirects.
Values (separate with | or alternative): !redirect, redirect
fulimit

How many to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
fucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=imageinfo (ii)

Returns file information and upload history.

Specific parameters:
Other general parameters are available.
iiprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
user
Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
userid
Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
comment
Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
thumbmime
Adds MIME type of the image thumbnail (requires url and param iiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
mediatype
Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

archivename
Adds the filename of the archive version for non-latest versions. If the file has been revision deleted, a filehidden property will be returned.
bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
uploadwarning
Used by the Special:Upload page to get information about an existing file. Not intended for use outside MediaWiki core.
badfile
Adds whether the file is on the MediaWiki:Bad image list
Values (separate with | or alternative): archivename, badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, thumbmime, timestamp, uploadwarning, url, user, userid
Default: timestamp|user
iilimit

How many file revisions to return per file.

Type: integer or max
The value must be between 1 and 500.
Default: 1
iistart

Timestamp to start listing from.

Type: timestamp (allowed formats)
iiend

Timestamp to stop listing at.

Type: timestamp (allowed formats)
iiurlwidth

If iiprop=url is set, a URL to an image scaled to this width will be returned. For performance reasons if this option is used, no more than 50 scaled images will be returned.

Type: integer
Default: -1
iiurlheight

Similar to iiurlwidth.

Type: integer
Default: -1
iimetadataversion

Version of metadata to use. If latest is specified, use latest version. Defaults to 1 for backwards compatibility.

Default: 1
iiextmetadatalanguage

What language to fetch extmetadata in. This affects both which translation to fetch, if multiple are available, as well as how things like numbers and various values are formatted.

Default: en
iiextmetadatamultilang

If translations for extmetadata property are available, fetch all of them.

Type: boolean (details)
iiextmetadatafilter

If specified and non-empty, only these keys will be returned for iiprop=extmetadata.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
iiurlparam

A handler specific parameter string. For example, PDFs might use page15-100px. iiurlwidth must be used and be consistent with iiurlparam.

Default: (empty)
iibadfilecontexttitle

If badfilecontexttitleprop=badfile is set, this is the page title used when evaluating the MediaWiki:Bad image list

iicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iilocalonly

Look only for files in the local repository.

Type: boolean (details)

prop=images (im)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all files contained on the given pages.

Specific parameters:
Other general parameters are available.
imlimit

How many files to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
imcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

imimages

Only list these files. Useful for checking whether a certain page has a certain file.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
imdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

prop=info (in)

Get basic page information.

Specific parameters:
Other general parameters are available.
inprop

Which additional properties to get:

protection
List the protection level of each page.
talkid
The page ID of the talk page for each non-talk page.
watched
List the watched status of each page.
watchlistlabels
List the watchlist labels for each page.
watchers
The number of watchers, if allowed.
visitingwatchers
The number of watchers of each page who have visited recent edits to that page, if allowed.
notificationtimestamp
The watchlist notification timestamp of each page.
subjectid
The page ID of the parent page for each talk page.
associatedpage
The prefixed title of the associated subject or talk page.
url
Gives a full URL, an edit URL, and the canonical URL for each page.
readable
Deprecated. Whether the user can read this page. Use intestactions=read instead.
preload
Deprecated. Gives the text returned by EditFormPreloadText. Use preloadcontent instead, which supports other kinds of preloaded text too.
preloadcontent
Gives the content to be shown in the editor when the page does not exist or while adding a new section.
editintro
Gives the intro messages that should be shown to the user while editing this page or revision, as HTML.
displaytitle
Gives the manner in which the page title is actually displayed.
varianttitles
Gives the display title in all variants of the site content language.
linkclasses
Gives the additional CSS classes (e.g. link colors) used for links to this page if they were to appear on the page named by inlinkcontext.
Values (separate with | or alternative): associatedpage, displaytitle, editintro, linkclasses, notificationtimestamp, preloadcontent, protection, subjectid, talkid, url, varianttitles, visitingwatchers, watched, watchers, watchlistlabels, preload, readable
inlinkcontext

The context title to use when determining extra CSS classes (e.g. link colors) when inprop contains linkclasses.

Type: page title
Accepts non-existent pages.
Default: Main Page
indefaultlinkcaption

Whether to consider the links as having a default caption (caption is a suffix of link target and preceded by slash, colon or start-of-string). It can have impact on the returned link classes.

Type: boolean (details)
intestactions

Test whether the current user can perform certain actions on the page.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
intestactionsdetail

Detail level for intestactions. Use the main module's errorformat and errorlang parameters to control the format of the messages returned.

boolean
Return a boolean value for each action.
full
Return messages describing why the action is disallowed, or an empty array if it is allowed.
quick
Like full but skipping expensive checks.
One of the following values: boolean, full, quick
Default: boolean
intestactionsautocreate

Test whether performing intestactions would automatically create a temporary account.

Type: boolean (details)
inpreloadcustom

Title of a custom page to use as preloaded content.

Only used when inprop contains preloadcontent.
inpreloadparams

Parameters for the custom page being used as preloaded content.

Only used when inprop contains preloadcontent.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
inpreloadnewsection

Return preloaded content for a new section on the page, rather than a new page.

Only used when inprop contains preloadcontent.
Type: boolean (details)
ineditintrostyle

Some intro messages come with optional wrapper frames. Use moreframes to include them or lessframes to omit them.

Only used when inprop contains editintro.
One of the following values: lessframes, moreframes
Default: moreframes
ineditintroskip

List of intro messages to remove from the response. Use this if a specific message is not relevant to your tool, or if the information is conveyed in a different way.

Only used when inprop contains editintro.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ineditintrocustom

Title of a custom page to use as an additional intro message.

Only used when inprop contains editintro.
incontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Returns all interwiki links from the given pages.

Specific parameters:
Other general parameters are available.
iwprop

Which additional properties to get for each interwiki link:

url
Adds the full URL.
Values (separate with | or alternative): url
iwprefix

Only return interwiki links with this prefix.

iwtitle

Interwiki link to search for. Must be used with iwprefix.

iwdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
iwlimit

How many interwiki links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
iwcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iwurl
Deprecated.

Whether to get the full URL (cannot be used with iwprop).

Type: boolean (details)

Returns all interlanguage links from the given pages.

Specific parameters:
Other general parameters are available.
llprop

Which additional properties to get for each interlanguage link:

url
Adds the full URL.
langname
Adds the localised language name (best effort). Use llinlanguagecode to control the language.
autonym
Adds the native language name.
Values (separate with | or alternative): autonym, langname, url
lllang

Only return language links with this language code.

lltitle

Link to search for. Must be used with lllang.

lldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
llinlanguagecode

Language code for localised language names.

Default: en
lllimit

How many langlinks to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
llcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

llurl
Deprecated.

Whether to get the full URL (cannot be used with llprop).

Type: boolean (details)
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all links from the given pages.

Specific parameters:
Other general parameters are available.
plnamespace

Show links in these namespaces only.

Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
pllimit

How many links to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
plcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

pltitles

Only list links to these titles. Useful for checking whether a certain page links to a certain title.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

prop=linkshere (lh)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given pages.

Specific parameters:
Other general parameters are available.
lhprop

Which properties to get:

pageid
Page ID of each page.
title
Title of each page.
redirect
Flag if the page is a redirect.
Values (separate with | or alternative): pageid, redirect, title
Default: pageid|title|redirect
lhnamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
lhshow

Show only items that meet these criteria:

redirect
Only show redirects.
!redirect
Only show non-redirects.
Values (separate with | or alternative): !redirect, redirect
lhlimit

How many to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
lhcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=pageimages (pi)

  • This module requires read rights.
  • Source: PageImages
  • License: WTFPL

Returns information about images on the page, such as thumbnail and presence of photos.

Specific parameters:
Other general parameters are available.
piprop

Which information to return:

thumbnail
URL and dimensions of thumbnail image associated with page, if any.
name
Image title.
original
URL and original dimensions of image associated with page, if any.
Values (separate with | or alternative): name, original, thumbnail
Default: thumbnail|name
pithumbsize

Maximum width in pixels of thumbnail images.

Type: integer
Default: 50
pilimit

Properties of how many pages to return.

Type: integer or max
The value must be between 1 and 50.
Default: 50
pilicense

Limit page images to a certain license type:

free
Only free images.
any
Best image, whether free or non-free.
One of the following values: any, free
Default: free
picontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
pilangcode

Code for the language the image is going to be rendered in if multiple languages are supported

Example:
Get name and 100-pixel thumbnail of an image on the Albert Einstein page.
api.php?action=query&prop=pageimages&titles=Albert%20Einstein&pithumbsize=100 [open in sandbox]

prop=pageprops (pp)

Get various page properties defined in the page content.

Specific parameters:
Other general parameters are available.
ppcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

ppprop

Only list these page properties (action=query&list=pagepropnames returns page property names in use). Useful for checking whether pages use a certain page property.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Example:
Get properties for the pages Main Page and MediaWiki.
api.php?action=query&prop=pageprops&titles=Main%20Page|MediaWiki [open in sandbox]

prop=pageterms (wbpt)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get the MonoCloud Wiki terms (typically labels, descriptions and aliases) associated with a page via a sitelink.

Specific parameters:
Other general parameters are available.
wbptcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
wbptlanguage

The language code to get terms in. If not specified, the user language is used.

One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uselang, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
Default: uselang
wbptterms

The types of terms to get, e.g. 'description', each returned as an array of strings keyed by their type, e.g. {"description": ["foo"]}. If not specified, all types are returned.

Values (separate with | or alternative): alias, description, label
Default: alias|label|description
Examples:
Get all terms associated with the page 'London', in the user language.
api.php?action=query&prop=pageterms&titles=London [open in sandbox]
Get labels and aliases associated with the page 'London', in English.
api.php?action=query&prop=pageterms&titles=London&wbptterms=label|alias&wbptlanguage=en [open in sandbox]

prop=redirects (rd)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all redirects to the given pages.

Specific parameters:
Other general parameters are available.
rdprop

Which properties to get:

pageid
Page ID of each redirect.
title
Title of each redirect.
fragment
Fragment of each redirect, if any.
Values (separate with | or alternative): fragment, pageid, title
Default: pageid|title
rdnamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
rdshow

Show only items that meet these criteria:

fragment
Only show redirects with a fragment.
!fragment
Only show redirects without a fragment.
Values (separate with | or alternative): !fragment, fragment
rdlimit

How many redirects to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
rdcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=revisions (rv)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get revision information.

May be used in several ways:

  1. Get data about a set of pages (last revision), by setting titles or pageids.
  2. Get revisions for one given page, by using titles or pageids with start, end, or limit.
  3. Get data about a set of revisions by setting their IDs with revids.
Specific parameters:
Other general parameters are available.
rvprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, rvlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, rvlimit is enforced to 50.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
rvslots

Which revision slots to return data for, when slot-related properties are included in rvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
rvcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of rvslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
rvlimit

Limit how many revisions will be returned. If rvprop=content, rvprop=parsetree, rvdiffto or rvdifftotext is used, the limit is 50. If rvparse is used, the limit is 1.

May only be used with a single page (mode #2).
Type: integer or max
The value must be between 1 and 500.
rvexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires rvprop=content).

Type: boolean (details)
rvgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires rvprop=content).

Type: boolean (details)
rvparse
Deprecated.

Use action=parse instead. Parse revision content (requires rvprop=content). For performance reasons, if this option is used, rvlimit is enforced to 1.

Type: boolean (details)
rvsection

Only retrieve the content of the section with this identifier.

rvdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, rvlimit is enforced to 50.

rvdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides rvdiffto. If rvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, rvlimit is enforced to 50.

rvdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with rvdifftotext.

Type: boolean (details)
rvcontentformat
Deprecated.

Serialization format used for rvdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
rvstartid

Start enumeration from the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.

May only be used with a single page (mode #2).
Type: integer
rvendid

Stop enumeration at the timestamp of the revision with this ID. The revision must exist, but need not belong to this page.

May only be used with a single page (mode #2).
Type: integer
rvstart

From which revision timestamp to start enumeration.

May only be used with a single page (mode #2).
Type: timestamp (allowed formats)
rvend

Enumerate up to this timestamp.

May only be used with a single page (mode #2).
Type: timestamp (allowed formats)
rvdir

In which direction to enumerate:

newer
List oldest first. Note: rvstart has to be before rvend.
older
List newest first (default). Note: rvstart has to be later than rvend.
May only be used with a single page (mode #2).
One of the following values: newer, older
Default: older
rvuser

Only include revisions made by user.

May only be used with a single page (mode #2).
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rvexcludeuser

Exclude revisions made by user.

May only be used with a single page (mode #2).
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rvtag

Only list revisions tagged with this tag.

rvcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=stashimageinfo (sii)

Returns file information for stashed files.

Specific parameters:
Other general parameters are available.
siifilekey

Key that identifies a previous upload that was stashed temporarily.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
siisessionkey
Deprecated.

Alias for siifilekey, for backward compatibility.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
siiprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
thumbmime
Adds MIME type of the image thumbnail (requires url and param siiurlwidth). If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
badfile
Adds whether the file is on the MediaWiki:Bad image list
Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, commonmetadata, dimensions, extmetadata, metadata, mime, sha1, size, thumbmime, timestamp, url
Default: timestamp|url
siiurlwidth

If siiprop=url is set, a URL to an image scaled to this width will be returned. For performance reasons if this option is used, no more than 50 scaled images will be returned.

Type: integer
Default: -1
siiurlheight

Similar to siiurlwidth.

Type: integer
Default: -1
siiurlparam

A handler specific parameter string. For example, PDFs might use page15-100px. siiurlwidth must be used and be consistent with siiurlparam.

Default: (empty)

prop=templates (tl)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Returns all pages transcluded on the given pages.

Specific parameters:
Other general parameters are available.
tlnamespace

Show templates in these namespaces only.

Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
tllimit

How many templates to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
tlcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tltemplates

Only list these templates. Useful for checking whether a certain page uses a certain template.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
tldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
Get the templates used on the page Main Page.
api.php?action=query&prop=templates&titles=Main%20Page [open in sandbox]
Get information about the template pages used on the page Main Page.
api.php?action=query&generator=templates&titles=Main%20Page&prop=info [open in sandbox]
Get pages in the User and Template namespaces that are transcluded on the page Main Page.
api.php?action=query&prop=templates&titles=Main%20Page&tlnamespace=2|10 [open in sandbox]

prop=transcludedin (ti)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that transclude the given pages.

Specific parameters:
Other general parameters are available.
tiprop

Which properties to get:

pageid
Page ID of each page.
title
Title of each page.
redirect
Flag if the page is a redirect.
Values (separate with | or alternative): pageid, redirect, title
Default: pageid|title|redirect
tinamespace

Only include pages in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
tishow

Show only items that meet these criteria:

redirect
Only show redirects.
!redirect
Only show non-redirects.
Values (separate with | or alternative): !redirect, redirect
tilimit

How many to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ticontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

prop=wbentityusage (wbeu)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Returns all entity IDs used in the given pages.

Specific parameters:
Other general parameters are available.
wbeuprop

Properties to add to the result.

url
If enabled url of entity will be added
Values (separate with | or alternative): url
wbeuaspect

Only return entity IDs that used this aspect.

S
The entity's sitelinks are used
L
The entity's label is used
D
The entity's description is used
T
The title of the local page corresponding to the entity is used
C
Statements from the entity are used
X
All aspects of an entity are or may be used
O
Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
Values (separate with | or alternative): C, D, L, O, S, T, X
wbeuentities

Only return page that used these entities.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wbeulimit

How many entity usages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wbeucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=abusefilters (abf)

Show details of the abuse filters.

Specific parameters:
Other general parameters are available.
abfstartid

The filter ID to start enumerating from.

Type: integer
abfendid

The filter ID to stop enumerating at.

Type: integer
abfdir

In which direction to enumerate:

One of the following values: newer, older
Default: newer
abfshow

Show only filters which meet these criteria.

Values (separate with | or alternative): !deleted, !enabled, !private, !protected, deleted, enabled, private, protected
abflimit

The maximum number of filters to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
abfprop

Which properties to get.

Values (separate with | or alternative): actions, comments, description, hits, id, lasteditor, lastedittime, pattern, private, protected, status
Default: id|description|actions|status

list=abuselog (afl)

Show events that were caught by one of the abuse filters.

Specific parameters:
Other general parameters are available.
afllogid

Show an entry with the given log ID.

Type: integer
aflstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
aflend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
afldir

In which direction to enumerate:

One of the following values: newer, older
Default: older
afluser

Show only entries done by a given user or IP address.

afltitle

Show only entries occurring on a given page.

aflfilter

Show only entries that were caught by the given filter IDs. Separate with pipes, prefix with "global-" for global filters.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
afllimit

The maximum amount of entries to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
aflprop

Which properties to get.

Values (separate with | or alternative): action, details, filter, hidden, ids, result, revid, timestamp, title, user
Default: ids|user|title|action|result|timestamp|hidden|revid

list=allcategories (ac)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all categories.

Specific parameters:
Other general parameters are available.
acfrom

The category to start enumerating from.

accontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

acto

The category to stop enumerating at.

acprefix

Search for all category titles that begin with this value.

acdir

Direction to sort in.

One of the following values: ascending, descending
Default: ascending
acmin

Only return categories with at least this many members.

Type: integer
acmax

Only return categories with at most this many members.

Type: integer
aclimit

How many categories to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
acprop

Which properties to get:

size
Adds number of pages in the category.
hidden
Tags categories that are hidden with __HIDDENCAT__.
Values (separate with | or alternative): hidden, size
Default: (empty)
Examples:
List categories with information on the number of pages in each.
api.php?action=query&list=allcategories&acprop=size [open in sandbox]
Retrieve info about the category page itself for categories beginning List.
api.php?action=query&generator=allcategories&gacprefix=List&prop=info [open in sandbox]

list=alldeletedrevisions (adr)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all deleted revisions by a user or in a namespace.

Specific parameters:
Other general parameters are available.
adrprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, adrlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, adrlimit is enforced to 50.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
adrslots

Which revision slots to return data for, when slot-related properties are included in adrprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
adrcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of adrslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
adrlimit

Limit how many revisions will be returned. If adrprop=content, adrprop=parsetree, adrdiffto or adrdifftotext is used, the limit is 50. If adrparse is used, the limit is 1.

Type: integer or max
The value must be between 1 and 500.
adrexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires adrprop=content).

Type: boolean (details)
adrgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires adrprop=content).

Type: boolean (details)
adrparse
Deprecated.

Use action=parse instead. Parse revision content (requires adrprop=content). For performance reasons, if this option is used, adrlimit is enforced to 1.

Type: boolean (details)
adrsection

Only retrieve the content of the section with this identifier.

adrdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, adrlimit is enforced to 50.

adrdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides adrdiffto. If adrsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, adrlimit is enforced to 50.

adrdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with adrdifftotext.

Type: boolean (details)
adrcontentformat
Deprecated.

Serialization format used for adrdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
adruser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
adrnamespace

Only list pages in this namespace.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
adrstart

The timestamp to start enumerating from.

May only be used with adruser.
Type: timestamp (allowed formats)
adrend

The timestamp to stop enumerating at.

May only be used with adruser.
Type: timestamp (allowed formats)
adrdir

In which direction to enumerate:

newer
List oldest first. Note: adrstart has to be before adrend.
older
List newest first (default). Note: adrstart has to be later than adrend.
One of the following values: newer, older
Default: older
adrfrom

Start listing at this title.

Cannot be used with adruser.
adrto

Stop listing at this title.

Cannot be used with adruser.
adrprefix

Search for all page titles that begin with this value.

Cannot be used with adruser.
adrexcludeuser

Don't list revisions by this user.

Cannot be used with adruser.
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
adrtag

Only list revisions tagged with this tag.

adrcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

adrgeneratetitles

When being used as a generator, generate titles rather than revision IDs.

Type: boolean (details)

list=allfileusages (af)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all file usages, including non-existing.

Specific parameters:
Other general parameters are available.
afcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

affrom

The title of the file to start enumerating from.

afto

The title of the file to stop enumerating at.

afprefix

Search for all file titles that begin with this value.

afunique

Only show distinct file titles. Cannot be used with afprop=ids. When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
afprop

Which pieces of information to include:

ids
Adds the page IDs of the using pages (cannot be used with afunique).
title
Adds the title of the file.
Values (separate with | or alternative): ids, title
Default: title
aflimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
afdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

list=allimages (ai)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all images sequentially.

Specific parameters:
Other general parameters are available.
aisort

Property to sort by.

One of the following values: name, timestamp
Default: name
aidir

The direction in which to list.

One of the following values: ascending, descending, newer, older
Default: ascending
aifrom

The image title to start enumerating from. Can only be used with aisort=name.

aito

The image title to stop enumerating at. Can only be used with aisort=name.

aicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

aistart

The timestamp to start enumerating from. Can only be used with aisort=timestamp.

Type: timestamp (allowed formats)
aiend

The timestamp to end enumerating. Can only be used with aisort=timestamp.

Type: timestamp (allowed formats)
aiprop

Which file information to get:

timestamp
Adds timestamp for the uploaded version.
user
Adds the user who uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
userid
Add the ID of the user that uploaded each file version. If the user has been revision deleted, a userhidden property will be returned.
comment
Comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parse the comment on the version. If the comment has been revision deleted, a commenthidden property will be returned.
canonicaltitle
Adds the canonical title of the file. If the file has been revision deleted, a filehidden property will be returned.
url
Gives URL to the file and the description page. If the file has been revision deleted, a filehidden property will be returned.
size
Adds the size of the file in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
sha1
Adds SHA-1 hash for the file. If the file has been revision deleted, a filehidden property will be returned.
mime
Adds MIME type of the file. If the file has been revision deleted, a filehidden property will be returned.
mediatype
Adds the media type of the file. If the file has been revision deleted, a filehidden property will be returned.
metadata
Lists Exif metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
commonmetadata
Lists file format generic metadata for the version of the file. If the file has been revision deleted, a filehidden property will be returned.
extmetadata
Lists formatted metadata combined from multiple sources. Results are HTML formatted. If the file has been revision deleted, a filehidden property will be returned.

Note: This is an expensive property to request, and should be avoided unless you need it. When using it, you should request only a few results at a time to avoid too much load.

bitdepth
Adds the bit depth of the version. If the file has been revision deleted, a filehidden property will be returned.
badfile
Adds whether the file is on the MediaWiki:Bad image list
Values (separate with | or alternative): badfile, bitdepth, canonicaltitle, comment, commonmetadata, dimensions, extmetadata, mediatype, metadata, mime, parsedcomment, sha1, size, timestamp, url, user, userid
Default: timestamp|url
aiprefix

Search for all image titles that begin with this value. Can only be used with aisort=name.

aiminsize

Limit to images with at least this many bytes.

Type: integer
aimaxsize

Limit to images with at most this many bytes.

Type: integer
aisha1

SHA1 hash of image. Overrides aisha1base36.

aisha1base36

SHA1 hash of image in base 36 (used in MediaWiki).

aiuser

Only return files where the last version was uploaded by this user. Can only be used with aisort=timestamp. Cannot be used together with aifilterbots.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
aifilterbots

How to filter files uploaded by bots. Can only be used with aisort=timestamp. Cannot be used together with aiuser.

One of the following values: all, bots, nobots
Default: all
aimime

What MIME types to search for, e.g. image/jpeg.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ailimit

How many images in total to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all links that point to a given namespace.

Specific parameters:
Other general parameters are available.
alcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

alfrom

The title of the link to start enumerating from.

alto

The title of the link to stop enumerating at.

alprefix

Search for all linked titles that begin with this value.

alunique

Only show distinct linked titles. Cannot be used with alprop=ids. When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
alprop

Which pieces of information to include:

ids
Adds the page ID of the linking page (cannot be used with alunique).
title
Adds the title of the link.
Values (separate with | or alternative): ids, title
Default: title
alnamespace

The namespace to enumerate.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
Default: 0
allimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
aldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
List linked titles, including missing ones, with page IDs they are from, starting at B.
api.php?action=query&list=alllinks&alfrom=B&alprop=ids|title [open in sandbox]
List unique linked titles.
api.php?action=query&list=alllinks&alunique=&alfrom=B [open in sandbox]
Gets all linked titles, marking the missing ones.
api.php?action=query&generator=alllinks&galunique=&galfrom=B [open in sandbox]
Gets pages containing the links.
api.php?action=query&generator=alllinks&galfrom=B [open in sandbox]

list=allpages (ap)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all pages sequentially in a given namespace.

Specific parameters:
Other general parameters are available.
apfrom

The page title to start enumerating from.

apcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

apto

The page title to stop enumerating at.

apprefix

Search for all page titles that begin with this value.

apnamespace

The namespace to enumerate.

One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
Default: 0
apfilterredir

Which pages to list.

One of the following values: all, nonredirects, redirects
Default: all
apfilterlanglinks

Filter based on whether a page has langlinks. Note that this may not consider langlinks added by extensions.

One of the following values: all, withlanglinks, withoutlanglinks
Default: all
apminsize

Limit to pages with at least this many bytes.

Type: integer
apmaxsize

Limit to pages with at most this many bytes.

Type: integer
apprtype

Limit to protected pages only.

Values (separate with | or alternative): edit, move, upload
apprlevel

Filter protections based on protection level (must be used with apprtype= parameter).

Values (separate with | or alternative): Can be empty, or autoconfirmed, sysop
apprfiltercascade

Filter protections based on cascadingness (ignored when apprtype isn't set).

One of the following values: all, cascading, noncascading
Default: all
apprexpiry

Which protection expiry to filter the page on:

indefinite
Get only pages with indefinite protection expiry.
definite
Get only pages with a definite (specific) protection expiry.
all
Get pages with any protections expiry.
One of the following values: all, definite, indefinite
Default: all
aplimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
apdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

list=allredirects (ar)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all redirects to a namespace.

Specific parameters:
Other general parameters are available.
arcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

arfrom

The title of the redirect to start enumerating from.

arto

The title of the redirect to stop enumerating at.

arprefix

Search for all target pages that begin with this value.

arunique

Only show distinct target pages. Cannot be used with arprop=ids|fragment|interwiki. When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
arprop

Which pieces of information to include:

ids
Adds the page ID of the redirecting page (cannot be used with arunique).
title
Adds the title of the redirect.
fragment
Adds the fragment from the redirect, if any (cannot be used with arunique).
interwiki
Adds the interwiki prefix from the redirect, if any (cannot be used with arunique).
Values (separate with | or alternative): fragment, ids, interwiki, title
Default: title
arnamespace

The namespace to enumerate.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
Default: 0
arlimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ardir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
List target pages, including missing ones, with page IDs they are from, starting at B.
api.php?action=query&list=allredirects&arfrom=B&arprop=ids|title [open in sandbox]
List unique target pages.
api.php?action=query&list=allredirects&arunique=&arfrom=B [open in sandbox]
Gets all target pages, marking the missing ones.
api.php?action=query&generator=allredirects&garunique=&garfrom=B [open in sandbox]
Gets pages containing the redirects.
api.php?action=query&generator=allredirects&garfrom=B [open in sandbox]

list=allrevisions (arv)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all revisions.

Specific parameters:
Other general parameters are available.
arvprop

Which properties to get for each revision:

ids
The ID of the revision.
flags
Revision flags (minor).
timestamp
The timestamp of the revision.
user
User that made the revision. If the user has been revision deleted, a userhidden property will be returned.
userid
User ID of the revision creator. If the user has been revision deleted, a userhidden property will be returned.
size
Length (bytes) of the revision.
slotsize
Length (bytes) of each revision slot.
sha1
SHA-1 (base 16) of the revision. If the content has been revision deleted, a sha1hidden property will be returned.
slotsha1
SHA-1 (base 16) of each revision slot. If the content has been revision deleted, a sha1hidden property will be returned.
contentmodel
Content model ID of each revision slot.
comment
Comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Parsed comment by the user for the revision. If the comment has been revision deleted, a commenthidden property will be returned.
content
Content of each revision slot. If the content has been revision deleted, a texthidden property will be returned. For performance reasons, if this option is used, arvlimit is enforced to 50.
tags
Tags for the revision.
roles
List content slot roles that exist in the revision.
parsetree
Deprecated. Use action=expandtemplates or action=parse instead. The XML parse tree of revision content (requires content model wikitext). For performance reasons, if this option is used, arvlimit is enforced to 50.
Values (separate with | or alternative): comment, content, contentmodel, flags, ids, parsedcomment, roles, sha1, size, slotsha1, slotsize, tags, timestamp, user, userid, parsetree
Default: ids|timestamp|flags|comment|user
arvslots

Which revision slots to return data for, when slot-related properties are included in arvprops. If omitted, data from the main slot will be returned in a backwards-compatible format.

Values (separate with | or alternative): main
To specify all values, use *.
arvcontentformat-{slot}

Content serialization format used for output of content.

This is a templated parameter. When making the request, {slot} in the parameter's name should be replaced with values of arvslots.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
arvlimit

Limit how many revisions will be returned. If arvprop=content, arvprop=parsetree, arvdiffto or arvdifftotext is used, the limit is 50. If arvparse is used, the limit is 1.

Type: integer or max
The value must be between 1 and 500.
arvexpandtemplates
Deprecated.

Use action=expandtemplates instead. Expand templates in revision content (requires arvprop=content).

Type: boolean (details)
arvgeneratexml
Deprecated.

Use action=expandtemplates or action=parse instead. Generate XML parse tree for revision content (requires arvprop=content).

Type: boolean (details)
arvparse
Deprecated.

Use action=parse instead. Parse revision content (requires arvprop=content). For performance reasons, if this option is used, arvlimit is enforced to 1.

Type: boolean (details)
arvsection

Only retrieve the content of the section with this identifier.

arvdiffto
Deprecated.

Use action=compare instead. Revision ID to diff each revision to. Use prev, next and cur for the previous, next and current revision respectively. For performance reasons, if this option is used, arvlimit is enforced to 50.

arvdifftotext
Deprecated.

Use action=compare instead. Text to diff each revision to. Only diffs a limited number of revisions. Overrides arvdiffto. If arvsection is set, only that section will be diffed against this text. For performance reasons, if this option is used, arvlimit is enforced to 50.

arvdifftotextpst
Deprecated.

Use action=compare instead. Perform a pre-save transform on the text before diffing it. Only valid when used with arvdifftotext.

Type: boolean (details)
arvcontentformat
Deprecated.

Serialization format used for arvdifftotext and expected for output of content.

One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
arvuser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
arvnamespace

Only list pages in this namespace.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
arvstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
arvend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
arvdir

In which direction to enumerate:

newer
List oldest first. Note: arvstart has to be before arvend.
older
List newest first (default). Note: arvstart has to be later than arvend.
One of the following values: newer, older
Default: older
arvexcludeuser

Don't list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
arvcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

arvgeneratetitles

When being used as a generator, generate titles rather than revision IDs.

Type: boolean (details)

list=alltransclusions (at)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all transclusions (pages embedded using {{x}}), including non-existing.

Specific parameters:
Other general parameters are available.
atcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

atfrom

The title of the transclusion to start enumerating from.

atto

The title of the transclusion to stop enumerating at.

atprefix

Search for all transcluded titles that begin with this value.

atunique

Only show distinct transcluded titles. Cannot be used with atprop=ids. When used as a generator, yields target pages instead of source pages.

Type: boolean (details)
atprop

Which pieces of information to include:

ids
Adds the page ID of the transcluding page (cannot be used with atunique).
title
Adds the title of the transclusion.
Values (separate with | or alternative): ids, title
Default: title
atnamespace

The namespace to enumerate.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
Default: 10
atlimit

How many total items to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
atdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
Examples:
List transcluded titles, including missing ones, with page IDs they are from, starting at B.
api.php?action=query&list=alltransclusions&atfrom=B&atprop=ids|title [open in sandbox]
List unique transcluded titles.
api.php?action=query&list=alltransclusions&atunique=&atfrom=B [open in sandbox]
Gets all transcluded titles, marking the missing ones.
api.php?action=query&generator=alltransclusions&gatunique=&gatfrom=B [open in sandbox]
Gets pages containing the transclusions.
api.php?action=query&generator=alltransclusions&gatfrom=B [open in sandbox]

list=allusers (au)

Enumerate all registered users.

Specific parameters:
Other general parameters are available.
aufrom

The username to start enumerating from.

auto

The username to stop enumerating at.

auprefix

Search for all users that begin with this value.

audir

Direction to sort in.

One of the following values: ascending, descending
Default: ascending
augroup

Only include users in the given groups. Does not include implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
auexcludegroup

Exclude users in the given groups.

Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
aurights

Only include users with the given rights. Does not include rights granted by implicit or auto-promoted groups like *, user, or autoconfirmed.

Values (separate with | or alternative): abusefilter-access-protected-vars, abusefilter-blocked-external-domains-log, abusefilter-bypass-blocked-external-domains, abusefilter-hidden-log, abusefilter-hide-log, abusefilter-log, abusefilter-log-detail, abusefilter-log-private, abusefilter-modify, abusefilter-modify-blocked-external-domains, abusefilter-modify-global, abusefilter-modify-restricted, abusefilter-privatedetails, abusefilter-privatedetails-log, abusefilter-protected-vars-log, abusefilter-revert, abusefilter-view, abusefilter-view-private, apihighlimits, applychangetags, autoconfirmed, autocreateaccount, autopatrol, badcaptcha, badoath, bigdelete, block, blockemail, bot, browsearchive, changeemail, changetags, checkuser, checkuser-log, checkuser-suggested-investigations, checkuser-temporary-account, checkuser-temporary-account-auto-reveal, checkuser-temporary-account-log, checkuser-temporary-account-no-preference, checkuser-userinfo, confirmemail, createaccount, createpage, createtalk, createwithcontentmodel, delete, delete-redirect, deletechangetags, deletedhistory, deletedtext, deletelogentry, deleterevision, disableoath, echo-create, echo-read-notifications, edit, editcontentmodel, editinterface, editmyoptions, editmyprivateinfo, editmyusercss, editmyuserjs, editmyuserjson, editmyuserjsredirect, editmywatchlist, editprotected, editsemiprotected, editsitecss, editsitejs, editsitejson, editusercss, edituserjs, edituserjson, hideuser, ignore-restricted-groups, import, importupload, interwiki, ipblock-exempt, ipinfo, ipinfo-ip-lookup, ipinfo-view-arbitrary-ip, ipinfo-view-basic, ipinfo-view-full, ipinfo-view-log, item-merge, item-redirect, item-term, linkpurge, logentryimport, mailpassword, manage-all-push-subscriptions, managechangetags, markbotedits, mergehistory, minoredit, move, move-categorypages, move-rootuserpages, move-subpages, movefile, nominornewtalk, noratelimit, nuke, oathauth-disable-for-user, oathauth-enable, oathauth-recover-for-user, oathauth-verify-user, oathauth-view-log, override-antispoof, override-export-depth, pagelang, patrol, patrolmarks, property-create, property-term, protect, purge, read, recover-2fa, renameuser, renameuser-global, renderfile, renderfile-nonstandard, replacetext, reupload, reupload-own, reupload-shared, rollback, sboverride, sendemail, siteadmin, skipcaptcha, spamblacklistlog, stashbasehtml, stashedit, suppressionlog, suppressredirect, suppressrevision, tboverride, tboverride-account, thanks-notification, titleblacklistlog, unblockself, undelete, unwatchedpages, upload, upload_by_url, userrights, userrights-interwiki, verify-2fa, viewmyprivateinfo, viewmywatchlist, viewsuppressed, wikibase-idgenerator, wikimediaevents-hcaptcha-diff-logging
Maximum number of values is 50 (500 for clients that are allowed higher limits).
auprop

Which pieces of information to include:

blockinfo
Adds the information about a current block on the user.
groups
Lists groups that the user is in. This uses more server resources and may return fewer results than the limit.
implicitgroups
Lists all the groups the user is automatically in.
rights
Lists rights that the user has.
editcount
Adds the edit count of the user.
registration
Adds the timestamp of when the user registered if available (may be blank).
centralids
Adds the central IDs and attachment status for the user.
tempexpired
Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
Values (separate with | or alternative): blockinfo, centralids, editcount, groups, implicitgroups, registration, rights, tempexpired
aulimit

How many total usernames to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
auwitheditsonly

Only list users who have made edits.

Type: boolean (details)
auactiveusers

Only list users active in the last 30 days.

Type: boolean (details)
auattachedwiki

With auprop=centralids, also indicate whether the user is attached with the wiki identified by this ID.

auexcludenamed

Exclude users of named accounts.

Type: boolean (details)
auexcludetemp

Exclude users of temporary accounts.

Type: boolean (details)
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given page.

Specific parameters:
Other general parameters are available.
bltitle

Title to search. Cannot be used together with blpageid.

blpageid

Page ID to search. Cannot be used together with bltitle.

Type: integer
blcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

blnamespace

The namespace to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
bldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
blfilterredir

How to filter for redirects. If set to nonredirects when blredirect is enabled, this is only applied to the second level.

One of the following values: all, nonredirects, redirects
Default: all
bllimit

How many total pages to return. If blredirect is enabled, the limit applies to each level separately (which means up to 2 * bllimit results may be returned).

Type: integer or max
The value must be between 1 and 500.
Default: 10
blredirect

If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.

Type: boolean (details)

list=blocks (bk)

List all blocked users and IP addresses.

Specific parameters:
Other general parameters are available.
bkstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
bkend

The timestamp to stop enumerating at.

Type: timestamp (allowed formats)
bkdir

In which direction to enumerate:

newer
List oldest first. Note: bkstart has to be before bkend.
older
List newest first (default). Note: bkstart has to be later than bkend.
One of the following values: newer, older
Default: older
bkids

List of block IDs to list (optional).

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bkusers

List of users to search for (optional).

Type: list of users, by any of username, IP, Temporary user and IP range
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
bkip

Get all blocks applying to this IP address or CIDR range, including range blocks. Cannot be used together with bkusers. CIDR ranges broader than IPv4/16 or IPv6/19 are not accepted.

bklimit

The maximum number of blocks to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
bkprop

Which properties to get:

id
Adds the ID of the block.
user
Adds the username of the blocked user.
userid
Adds the user ID of the blocked user.
by
Adds the username of the blocking user.
byid
Adds the user ID of the blocking user.
timestamp
Adds the timestamp of when the block was given.
expiry
Adds the timestamp of when the block expires.
reason
Adds the reason given for the block.
parsedreason
Adds the parsed reason given for the block.
range
Adds the range of IP addresses affected by the block.
flags
Tags the ban with (autoblock, anononly, etc.).
restrictions
Adds the partial block restrictions if the block is not sitewide.
Values (separate with | or alternative): by, byid, expiry, flags, id, parsedreason, range, reason, restrictions, timestamp, user, userid
Default: id|user|by|timestamp|expiry|reason|flags
bkshow

Show only items that meet these criteria. For example, to see only indefinite blocks on IP addresses, set bkshow=ip|!temp.

Values (separate with | or alternative): !account, !ip, !range, !temp, account, ip, range, temp
bkcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=categorymembers (cm)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all pages in a given category.

Specific parameters:
Other general parameters are available.
cmtitle

Which category to enumerate (required). Must include the Category: prefix. Cannot be used together with cmpageid.

cmpageid

Page ID of the category to enumerate. Cannot be used together with cmtitle.

Type: integer
cmprop

Which pieces of information to include:

ids
Adds the page ID.
title
Adds the title and namespace ID of the page.
sortkey
Adds the sortkey used for sorting in the category (hexadecimal string).
sortkeyprefix
Adds the sortkey prefix used for sorting in the category (human-readable part of the sortkey).
type
Adds the type that the page has been categorised as (page, subcat or file).
timestamp
Adds the timestamp of when the page was included.
Values (separate with | or alternative): ids, sortkey, sortkeyprefix, timestamp, title, type
Default: ids|title
cmnamespace

Only include pages in these namespaces. Note that cmtype=subcat or cmtype=file may be used instead of cmnamespace=14 or 6.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
cmtype

Which type of category members to include. Ignored when cmsort=timestamp is set.

Values (separate with | or alternative): file, page, subcat
Default: page|subcat|file
cmcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

cmlimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
cmsort

Property to sort by.

One of the following values: sortkey, timestamp
Default: sortkey
cmdir

In which direction to sort.

One of the following values: asc, ascending, desc, descending, newer, older
Default: ascending
cmstart

Timestamp to start listing from. Can only be used with cmsort=timestamp.

Type: timestamp (allowed formats)
cmend

Timestamp to end listing at. Can only be used with cmsort=timestamp.

Type: timestamp (allowed formats)
cmstarthexsortkey

Sortkey to start listing from, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.

cmendhexsortkey

Sortkey to end listing at, as returned by cmprop=sortkey. Can only be used with cmsort=sortkey.

cmstartsortkeyprefix

Sortkey prefix to start listing from. Can only be used with cmsort=sortkey. Overrides cmstarthexsortkey.

cmendsortkeyprefix

Sortkey prefix to end listing before (not at; if this value occurs it will not be included!). Can only be used with cmsort=sortkey. Overrides cmendhexsortkey.

cmstartsortkey
Deprecated.

Use cmstarthexsortkey instead.

cmendsortkey
Deprecated.

Use cmendhexsortkey instead.

list=checkuser (cu)

  • This module is deprecated.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: CheckUser
  • License: GPL-2.0-or-later

This API has been disabled by the site administrators. Querying the API will return no data. Check which IP addresses are used by a given username or which usernames are used by a given IP address.

Specific parameters:
Other general parameters are available.
curequest

Type of CheckUser request:

userips
Get IP address of target user.
edits
Deprecated. Get actions performed by target IP address or range.
actions
Get actions performed by target IP address or range.
ipusers
Get users from target IP address or range.
This parameter is required.
One of the following values: actions, ipusers, userips, edits
cutarget

Username, IP address, or CIDR range to check.

This parameter is required.
Type: user, by any of username, IP, Temporary user and IP range
cureason

Reason to check.

This parameter is required.
Default: (empty)
culimit

Limit of rows.

Type: integer or max
The value must be between 1 and 500.
Default: 500
cutimecond

Time limit of user data (like "-2 weeks" or "2 weeks ago").

Default: -2 weeks
cuxff

Use XFF data instead of IP address.

cutoken

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

list=checkuserlog (cul)

Get entries from the CheckUser log.

Specific parameters:
Other general parameters are available.
culuser

Username of the CheckUser.

cultarget

Checked user, IP address, or CIDR range.

culreason

Reason given for the check.

cullimit

Limit of rows.

Type: integer or max
The value must be between 1 and 500.
Default: 10
culdir

In which direction to enumerate:

newer
List oldest first. Note: culfrom has to be before culto.
older
List newest first (default). Note: culfrom has to be later than culto.
One of the following values: newer, older
Default: older
culfrom

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
culto

The timestamp to end enumerating.

Type: timestamp (allowed formats)
culcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=codexicons

Get Codex icons

Specific parameter:
Other general parameters are available.
names

Names of icons

This parameter is required.
Values (separate with | or alternative): cdxIconAdd, cdxIconAlert, cdxIconAlignCenter, cdxIconAlignLeft, cdxIconAlignRight, cdxIconAppearance, cdxIconArrowDown, cdxIconArrowNext, cdxIconArrowPrevious, cdxIconArrowUp, cdxIconArticle, cdxIconArticleAdd, cdxIconArticleCheck, cdxIconArticleDisambiguation, cdxIconArticleNotFound, cdxIconArticleRedirect, cdxIconArticleSearch, cdxIconArticles, cdxIconArticlesSearch, cdxIconAttachment, cdxIconBell, cdxIconBellOutline, cdxIconBigger, cdxIconBlock, cdxIconBold, cdxIconBook, cdxIconBookmark, cdxIconBookmarkList, cdxIconBookmarkOutline, cdxIconBright, cdxIconBrowser, cdxIconCalendar, cdxIconCamera, cdxIconCancel, cdxIconChart, cdxIconCheck, cdxIconCheckAll, cdxIconClear, cdxIconClock, cdxIconClose, cdxIconCode, cdxIconCollapse, cdxIconConfigure, cdxIconCopy, cdxIconCut, cdxIconDatabase, cdxIconDie, cdxIconDoubleChevronEnd, cdxIconDoubleChevronStart, cdxIconDownTriangle, cdxIconDownload, cdxIconDraggable, cdxIconEdit, cdxIconEditLock, cdxIconEditUndo, cdxIconEllipsis, cdxIconError, cdxIconExitFullscreen, cdxIconExpand, cdxIconEye, cdxIconEyeClosed, cdxIconFeedback, cdxIconFlag, cdxIconFolderPlaceholder, cdxIconFullscreen, cdxIconFunction, cdxIconFunctionArgument, cdxIconFunnel, cdxIconGlobe, cdxIconHalfBright, cdxIconHalfStar, cdxIconHand, cdxIconHeart, cdxIconHelp, cdxIconHelpNotice, cdxIconHieroglyph, cdxIconHighlight, cdxIconHistory, cdxIconHome, cdxIconImage, cdxIconImageAdd, cdxIconImageBroken, cdxIconImageGallery, cdxIconImageLayoutBasic, cdxIconImageLayoutFrame, cdxIconImageLayoutFrameless, cdxIconImageLayoutThumbnail, cdxIconImageLock, cdxIconIndent, cdxIconInfo, cdxIconInfoFilled, cdxIconInstance, cdxIconItalic, cdxIconJournal, cdxIconKey, cdxIconKeyboard, cdxIconLabFlask, cdxIconLanguage, cdxIconLargerText, cdxIconLayout, cdxIconLightbulb, cdxIconLink, cdxIconLinkExternal, cdxIconLinkSecure, cdxIconListBullet, cdxIconListNumbered, cdxIconLiteral, cdxIconLock, cdxIconLogIn, cdxIconLogOut, cdxIconLogoCC, cdxIconLogoCodex, cdxIconLogoMediaWiki, cdxIconLogoMetaWiki, cdxIconLogoWikibooks, cdxIconLogoWikidata, cdxIconLogoWikifunctions, cdxIconLogoWikimedia, cdxIconLogoWikimediaCommons, cdxIconLogoWikimediaDiscovery, cdxIconLogoWikinews, cdxIconLogoWikipedia, cdxIconLogoWikiquote, cdxIconLogoWikisource, cdxIconLogoWikispecies, cdxIconLogoWikiversity, cdxIconLogoWikivoyage, cdxIconLogoWiktionary, cdxIconMap, cdxIconMapPin, cdxIconMapPinAdd, cdxIconMapTrail, cdxIconMarkup, cdxIconMathematics, cdxIconMathematicsDisplayBlock, cdxIconMathematicsDisplayDefault, cdxIconMathematicsDisplayInline, cdxIconMenu, cdxIconMerge, cdxIconMessage, cdxIconMoon, cdxIconMove, cdxIconMoveFirst, cdxIconMoveLast, cdxIconMusicalScore, cdxIconNetwork, cdxIconNetworkOff, cdxIconNewWindow, cdxIconNewline, cdxIconNewspaper, cdxIconNext, cdxIconNoWikitext, cdxIconNotBright, cdxIconNotice, cdxIconOngoingConversation, cdxIconOutdent, cdxIconOutline, cdxIconPageSettings, cdxIconPalette, cdxIconPaste, cdxIconPause, cdxIconPlay, cdxIconPower, cdxIconPrevious, cdxIconPrinter, cdxIconPushPin, cdxIconPuzzle, cdxIconQrCode, cdxIconQuotes, cdxIconRecentChanges, cdxIconRedo, cdxIconReference, cdxIconReferenceExisting, cdxIconReferences, cdxIconReload, cdxIconRestore, cdxIconRobot, cdxIconSandbox, cdxIconSearch, cdxIconSearchCaseSensitive, cdxIconSearchDiacritics, cdxIconSearchRegularExpression, cdxIconSettings, cdxIconShare, cdxIconSignature, cdxIconSmaller, cdxIconSmallerText, cdxIconSortVertical, cdxIconSpecialCharacter, cdxIconSpecialPages, cdxIconSpeechBubble, cdxIconSpeechBubbleAdd, cdxIconSpeechBubbles, cdxIconStar, cdxIconStop, cdxIconStrikethrough, cdxIconSubscript, cdxIconSubtract, cdxIconSuccess, cdxIconSuperscript, cdxIconTable, cdxIconTableAddColumnAfter, cdxIconTableAddColumnBefore, cdxIconTableAddRowAfter, cdxIconTableAddRowBefore, cdxIconTableCaption, cdxIconTableMergeCells, cdxIconTableMoveColumnAfter, cdxIconTableMoveColumnBefore, cdxIconTableMoveRowAfter, cdxIconTableMoveRowBefore, cdxIconTag, cdxIconTemplateAdd, cdxIconTextDirLTR, cdxIconTextDirRTL, cdxIconTextFlow, cdxIconTextStyle, cdxIconTextSummary, cdxIconTrash, cdxIconTray, cdxIconUnBlock, cdxIconUnFlag, cdxIconUnLink, cdxIconUnLock, cdxIconUnStar, cdxIconUnderline, cdxIconUndo, cdxIconUpTriangle, cdxIconUpdate, cdxIconUpload, cdxIconUserActive, cdxIconUserAdd, cdxIconUserAnonymous, cdxIconUserAvatar, cdxIconUserAvatarOutline, cdxIconUserBlocked, cdxIconUserContributions, cdxIconUserGroup, cdxIconUserRights, cdxIconUserTalk, cdxIconUserTemporary, cdxIconUserTemporaryLocation, cdxIconViewCompact, cdxIconViewDetails, cdxIconVisionSimulator, cdxIconVolumeDown, cdxIconVolumeOff, cdxIconVolumeUp, cdxIconWatchlist, cdxIconWikitext, cdxIconWindow, cdxIconZoomIn, cdxIconZoomOut
Maximum number of values is 50 (500 for clients that are allowed higher limits).
To specify all values, use *.

list=deletedrevs (dr)

  • This module is deprecated.
  • This module requires read rights.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List deleted revisions.

Operates in three modes:

  1. List deleted revisions for the given titles, sorted by timestamp.
  2. List deleted contributions for the given user, sorted by timestamp (no titles specified).
  3. List all deleted revisions in the given namespace, sorted by title and timestamp (no titles specified, druser not set).

Certain parameters only apply to some modes and are ignored in others.

Specific parameters:
Other general parameters are available.
drstart

The timestamp to start enumerating from.

Modes: 1, 2
Type: timestamp (allowed formats)
drend

The timestamp to stop enumerating at.

Modes: 1, 2
Type: timestamp (allowed formats)
drdir

In which direction to enumerate:

newer
List oldest first. Note: drstart has to be before drend.
older
List newest first (default). Note: drstart has to be later than drend.
Modes: 1, 3
One of the following values: newer, older
Default: older
drfrom

Start listing at this title.

Mode: 3
drto

Stop listing at this title.

Mode: 3
drprefix

Search for all page titles that begin with this value.

Mode: 3
drunique

List only one revision for each page.

Mode: 3
Type: boolean (details)
drnamespace

Only list pages in this namespace.

Mode: 3
One of the following values: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
Default: 0
drtag

Only list revisions tagged with this tag.

druser

Only list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drexcludeuser

Don't list revisions by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
drprop

Which properties to get:

revid
Adds the revision ID of the deleted revision.
parentid
Adds the revision ID of the previous revision to the page.
user
Adds the user who made the revision.
userid
Adds the ID of the user who made the revision.
comment
Adds the comment of the revision.
parsedcomment
Adds the parsed comment of the revision.
minor
Tags if the revision is minor.
len
Adds the length (bytes) of the revision.
sha1
Adds the SHA-1 (base 16) of the revision.
content
Adds the content of the revision. For performance reasons, if this option is used, drlimit is enforced to 50.
token
Deprecated. Gives the edit token.
tags
Tags for the revision.
Values (separate with | or alternative): comment, content, len, minor, parentid, parsedcomment, revid, sha1, tags, user, userid, token
Default: user|comment
drlimit

The maximum amount of revisions to list. If drprop=content is used, the limit is 50.

Type: integer or max
The value must be between 1 and 500.
Default: 10
drcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
List the last deleted revisions of the pages Main Page and Talk:Main Page, with content (mode 1).
api.php?action=query&list=deletedrevs&titles=Main%20Page|Talk%3AMain%20Page&drprop=user|comment|content [open in sandbox]
List the last 50 deleted contributions by Bob (mode 2).
api.php?action=query&list=deletedrevs&druser=Bob&drlimit=50 [open in sandbox]
List the first 50 deleted revisions in the main namespace (mode 3).
api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50 [open in sandbox]
List the first 50 deleted pages in the Talk namespace (mode 3).
api.php?action=query&list=deletedrevs&drdir=newer&drlimit=50&drnamespace=1&drunique= [open in sandbox]

list=embeddedin (ei)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that embed (transclude) the given title.

Specific parameters:
Other general parameters are available.
eititle

Title to search. Cannot be used together with eipageid.

eipageid

Page ID to search. Cannot be used together with eititle.

Type: integer
eicontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

einamespace

The namespace to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
eidir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
eifilterredir

How to filter for redirects.

One of the following values: all, nonredirects, redirects
Default: all
eilimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=exturlusage (eu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate pages that contain a given URL.

Specific parameters:
Other general parameters are available.
euprop

Which pieces of information to include:

ids
Adds the ID of page.
title
Adds the title and namespace ID of the page.
url
Adds the URL used in the page.
Values (separate with | or alternative): ids, title, url
Default: ids|title|url
eucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

euprotocol

Protocol of the URL. If empty and euquery is set, the protocol is http and https. Leave both this and euquery empty to list all external links.

One of the following values: Can be empty, or bitcoin, ftp, ftps, geo, git, gopher, http, https, irc, ircs, magnet, mailto, matrix, mms, news, nntp, redis, sftp, sip, sips, sms, ssh, svn, tel, telnet, urn, wikipedia, worldwind, xmpp
Default: (empty)
euquery

Search string without protocol. See Special:LinkSearch. Leave empty to list all external links.

eunamespace

The page namespaces to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
eulimit

How many pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
euexpandurl
Deprecated.

Expand protocol-relative URLs with the canonical protocol.

Type: boolean (details)

list=filearchive (fa)

Enumerate all deleted files sequentially.

Specific parameters:
Other general parameters are available.
fafrom

The image title to start enumerating from.

fato

The image title to stop enumerating at.

faprefix

Search for all image titles that begin with this value.

fadir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
fasha1

SHA1 hash of image. Overrides fasha1base36.

fasha1base36

SHA1 hash of image in base 36 (used in MediaWiki).

faprop

Which image information to get:

sha1
Adds SHA-1 hash for the image.
timestamp
Adds timestamp for the uploaded version.
user
Adds user who uploaded the image version.
size
Adds the size of the image in bytes and the height, width and page count (if applicable).
dimensions
Alias for size.
description
Adds description of the image version.
parseddescription
Parse the description of the version.
mime
Adds MIME of the image.
mediatype
Adds the media type of the image.
metadata
Lists Exif metadata for the version of the image.
bitdepth
Adds the bit depth of the version.
archivename
Adds the filename of the archive version for non-latest versions.
Values (separate with | or alternative): archivename, bitdepth, description, dimensions, mediatype, metadata, mime, parseddescription, sha1, size, timestamp, user
Default: timestamp
falimit

How many images to return in total.

Type: integer or max
The value must be between 1 and 500.
Default: 10
facontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Show a list of all deleted files.
api.php?action=query&list=filearchive [open in sandbox]

list=gadgetcategories (gc)

Returns a list of gadget sections.

Specific parameters:
Other general parameters are available.
gcprop

What gadget section information to get:

name
Internal section name.
title
Section title.
members
Number of gadgets in section.
Values (separate with | or alternative): members, name, title
Default: name
gcnames

Names of sections to retrieve.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

list=gadgets (ga)

Returns a list of gadgets used on this wiki.

Specific parameters:
Other general parameters are available.
gaprop

What gadget information to get:

id
Internal gadget ID.
metadata
The gadget metadata.
desc
Gadget description transformed into HTML (can be slow, use only if really needed).
Values (separate with | or alternative): desc, id, metadata
Default: id|metadata
gacategories

Gadgets from what categories to retrieve.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
gaids

IDs of gadgets to retrieve.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
gaallowedonly

List only gadgets allowed to current user.

Type: boolean (details)
gaenabledonly

List only gadgets enabled by current user.

Type: boolean (details)
Examples:
Get a list of gadgets along with their descriptions
api.php?action=query&list=gadgets&gaprop=id|desc [open in sandbox]
Get a list of gadgets with all possible properties
api.php?action=query&list=gadgets&gaprop=id|metadata|desc [open in sandbox]
Get a list of gadgets belonging to category "foo"
api.php?action=query&list=gadgets&gacategories=foo [open in sandbox]
Get information about gadgets "foo" and "bar"
api.php?action=query&list=gadgets&gaids=foo|bar&gaprop=id|desc|metadata [open in sandbox]
Get a list of gadgets enabled by current user
api.php?action=query&list=gadgets&gaenabledonly [open in sandbox]

list=imageusage (iu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that use the given image title.

Specific parameters:
Other general parameters are available.
iutitle

Title to search. Cannot be used together with iupageid.

iupageid

Page ID to search. Cannot be used together with iutitle.

Type: integer
iucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iunamespace

The namespace to enumerate.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
iudir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
iufilterredir

How to filter for redirects. If set to nonredirects when iuredirect is enabled, this is only applied to the second level.

One of the following values: all, nonredirects, redirects
Default: all
iulimit

How many total pages to return. If iuredirect is enabled, the limit applies to each level separately (which means up to 2 * iulimit results may be returned).

Type: integer or max
The value must be between 1 and 500.
Default: 10
iuredirect

If linking page is a redirect, find all pages that link to that redirect as well. Maximum limit is halved.

Type: boolean (details)
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given interwiki link.

Can be used to find all links with a prefix, or all links to a title (with a given prefix). Using neither parameter is effectively "all interwiki links".

Specific parameters:
Other general parameters are available.
iwblprefix

Prefix for the interwiki.

iwbltitle

Interwiki link to search for. Must be used with iwblblprefix.

iwblcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

iwbllimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
iwblprop

Which properties to get:

iwprefix
Adds the prefix of the interwiki.
iwtitle
Adds the title of the interwiki.
Values (separate with | or alternative): iwprefix, iwtitle
Default: (empty)
iwbldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Find all pages that link to the given language link.

Can be used to find all links with a language code, or all links to a title (with a given language). Using neither parameter is effectively "all language links".

Note that this may not consider language links added by extensions.

Specific parameters:
Other general parameters are available.
lbllang

Language for the language link.

lbltitle

Language link to search for. Must be used with lbllang.

lblcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

lbllimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
lblprop

Which properties to get:

lllang
Adds the language code of the language link.
lltitle
Adds the title of the language link.
Values (separate with | or alternative): lllang, lltitle
Default: (empty)
lbldir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending

list=linterrors (lnt)

Get a list of lint errors

Specific parameters:
Other general parameters are available.
lntcategories

Categories of lint errors

Values (separate with | or alternative): bogus-image-options, deletable-table-tag, duplicate-ids, empty-heading, fostered, fostered-transparent, html5-misnesting, large-tables, misc-tidy-replacement-issues, misnested-tag, missing-end-tag, missing-end-tag-in-heading, multi-colon-escape, multiline-html-table-in-list, multiple-unclosed-formatting-tags, night-mode-unaware-background-color, obsolete-tag, pwrap-bug-workaround, self-closed-tag, stripped-tag, template-arg-in-extension-tag, tidy-font-bug, tidy-whitespace-bug, unclosed-quotes-in-heading, wikilink-in-extlink
Default: deletable-table-tag|duplicate-ids|html5-misnesting|misc-tidy-replacement-issues|multiline-html-table-in-list|multiple-unclosed-formatting-tags|pwrap-bug-workaround|self-closed-tag|template-arg-in-extension-tag|tidy-font-bug|tidy-whitespace-bug|unclosed-quotes-in-heading|bogus-image-options|fostered|misnested-tag|multi-colon-escape|wikilink-in-extlink|empty-heading|missing-end-tag|missing-end-tag-in-heading|night-mode-unaware-background-color|obsolete-tag|stripped-tag
lntlimit

Number of results to query

Type: integer or max
The value must be between 1 and 500.
Default: 10
lntnamespace

Only include lint errors from the specified namespaces

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
lntpageid

Only include lint errors from the specified page IDs

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
lnttitle

Only include lint errors from the specified page title

lntfrom

Lint ID to start querying from

Type: integer
Example:
Get all lint errors of the obsolete-tag category
api.php?action=query&list=linterrors&lntcategories=obsolete-tag [open in sandbox]

list=logevents (le)

Get events from logs.

Specific parameters:
Other general parameters are available.
leprop

Which properties to get:

ids
Adds the ID of the log event.
title
Adds the title of the page for the log event.
type
Adds the type of log event.
user
Adds the user responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
userid
Adds the user ID who was responsible for the log event. If the user has been revision deleted, a userhidden property will be returned.
timestamp
Adds the timestamp for the log event.
comment
Adds the comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds the parsed comment of the log event. If the comment has been revision deleted, a commenthidden property will be returned.
details
Lists additional details about the log event. If the log event has been revision deleted, an actionhidden property will be returned.
tags
Lists tags for the log event.
Values (separate with | or alternative): comment, details, ids, parsedcomment, tags, timestamp, title, type, user, userid
Default: ids|title|type|user|timestamp|comment|details
letype

Filter log entries to only this type.

One of the following values: Can be empty, or abusefilter, abusefilter-protected-vars, abusefilterblockeddomainhit, abusefilterprivatedetails, block, checkuser-temporary-account, contentmodel, create, delete, import, interwiki, ipinfo, managetags, merge, move, newusers, oath, patrol, protect, renameuser, rights, spamblacklist, suppress, tag, thanks, titleblacklist, upload
leaction

Filter log actions to only this action. Overrides letype. In the list of possible values, values with the asterisk wildcard such as action/* can have different strings after the slash (/).

One of the following values: abusefilter-protected-vars/*, abusefilter/create, abusefilter/hit, abusefilter/modify, abusefilterblockeddomainhit/*, abusefilterprivatedetails/access, block/block, block/reblock, block/unblock, checkuser-private-event/*, checkuser-temporary-account/*, contentmodel/change, contentmodel/new, create/create, delete/delete, delete/delete_redir, delete/delete_redir2, delete/event, delete/restore, delete/revision, import/interwiki, import/upload, interwiki/iw_add, interwiki/iw_delete, interwiki/iw_edit, ipinfo/*, managetags/activate, managetags/create, managetags/deactivate, managetags/delete, merge/merge, merge/merge-into, move/move, move/move_redir, newusers/autocreate, newusers/byemail, newusers/create, newusers/create2, newusers/newusers, oath/*, patrol/autopatrol, patrol/patrol, protect/modify, protect/move_prot, protect/protect, protect/unprotect, renameuser/renameuser, rights/autopromote, rights/blockautopromote, rights/restoreautopromote, rights/rights, spamblacklist/*, suppress/block, suppress/delete, suppress/event, suppress/hide-afl, suppress/reblock, suppress/revision, suppress/unhide-afl, tag/update, thanks/*, titleblacklist/*, upload/overwrite, upload/revert, upload/upload
lestart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
leend

The timestamp to end enumerating.

Type: timestamp (allowed formats)
ledir

In which direction to enumerate:

newer
List oldest first. Note: lestart has to be before leend.
older
List newest first (default). Note: lestart has to be later than leend.
One of the following values: newer, older
Default: older
leids

Filter entries to those matching the given log ID(s).

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
leuser

Filter entries to those made by the given user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
letitle

Filter entries to those related to a page.

lenamespace

Filter entries to those in the given namespace.

One of the following values: -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
leprefix

Filter entries that start with this prefix.

letag

Only list event entries tagged with this tag.

lelimit

How many total event entries to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
lecontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=mystashedfiles (msf)

Get a list of files in the current user's upload stash.

Specific parameters:
Other general parameters are available.
msfprop

Which properties to fetch for the files.

size
Fetch the file size and image dimensions.
type
Fetch the file's MIME type and media type.
Values (separate with | or alternative): size, type
Default: (empty)
msflimit

How many files to get.

Type: integer or max
The value must be between 1 and 500.
Default: 10
msfcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Example:
Get the filekey, file size, and pixel size of files in the current user's upload stash.
api.php?action=query&list=mystashedfiles&msfprop=size [open in sandbox]

list=pagepropnames (ppn)

List all page property names in use on the wiki.

Specific parameters:
Other general parameters are available.
ppncontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

ppnlimit

The maximum number of names to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=pageswithprop (pwp)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all pages using a given page property.

Specific parameters:
Other general parameters are available.
pwppropname

Page property for which to enumerate pages (action=query&list=pagepropnames returns page property names in use).

This parameter is required.
pwpprop

Which pieces of information to include:

ids
Adds the page ID.
title
Adds the title and namespace ID of the page.
value
Adds the value of the page property.
Values (separate with | or alternative): ids, title, value
Default: ids|title
pwpcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

pwplimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
pwpdir

In which direction to sort.

One of the following values: ascending, descending
Default: ascending

list=prefixsearch (ps)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Perform a prefix search for page titles.

Despite the similarity in names, this module is not intended to be equivalent to Special:PrefixIndex; for that, see action=query&list=allpages with the apprefix parameter. The purpose of this module is similar to action=opensearch: to take user input and provide the best-matching titles. Depending on the search engine backend, this might include typo correction, redirect avoidance, or other heuristics.

Specific parameters:
Other general parameters are available.
pssearch

Search string.

This parameter is required.
psnamespace

Namespaces to search. Ignored if pssearch begins with a valid namespace prefix.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
Default: 0
pslimit

Maximum number of results to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
psoffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
The value must be no less than 0.
Default: 0
Example:
Search for page titles beginning with meaning.
api.php?action=query&list=prefixsearch&pssearch=meaning [open in sandbox]

list=protectedtitles (pt)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

List all titles protected from creation.

Specific parameters:
Other general parameters are available.
ptnamespace

Only list titles in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
ptlevel

Only list titles with these protection levels.

Values (separate with | or alternative): autoconfirmed, sysop
ptlimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ptdir

In which direction to enumerate:

newer
List oldest first. Note: ptstart has to be before ptend.
older
List newest first (default). Note: ptstart has to be later than ptend.
One of the following values: newer, older
Default: older
ptstart

Start listing at this protection timestamp.

Type: timestamp (allowed formats)
ptend

Stop listing at this protection timestamp.

Type: timestamp (allowed formats)
ptprop

Which properties to get:

timestamp
Adds the timestamp of when protection was added.
user
Adds the user that added the protection.
userid
Adds the user ID that added the protection.
comment
Adds the comment for the protection.
parsedcomment
Adds the parsed comment for the protection.
expiry
Adds the timestamp of when the protection will be lifted.
level
Adds the protection level.
Values (separate with | or alternative): comment, expiry, level, parsedcomment, timestamp, user, userid
Default: timestamp|level
ptcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=querypage (qp)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get a list provided by a QueryPage-based special page.

Specific parameters:
Other general parameters are available.
qppage

The name of the special page. Note, this is case-sensitive.

This parameter is required.
One of the following values: Ancientpages, BrokenRedirects, Deadendpages, DoubleRedirects, Fewestrevisions, GadgetUsage, LintTemplateErrors, ListDuplicatedFiles, Listredirects, Lonelypages, Longpages, MediaStatistics, Mostcategories, Mostimages, Mostinterwikis, Mostlinked, Mostlinkedcategories, Mostlinkedtemplates, Mostrevisions, Shortpages, Uncategorizedcategories, Uncategorizedimages, Uncategorizedpages, Uncategorizedtemplates, UnconnectedPages, Unusedcategories, Unusedimages, Unusedtemplates, Unwatchedpages, Wantedcategories, Wantedfiles, Wantedpages, Wantedtemplates, Withoutinterwiki
qpoffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
Default: 0
qplimit

Number of results to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10

list=random (rn)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get a set of random pages.

Pages are listed in a fixed sequence, only the starting point is random. This means that if, for example, Main Page is the first random page in the list, List of fictional monkeys will always be second, List of people on stamps of Vanuatu third, etc.

Specific parameters:
Other general parameters are available.
rnnamespace

Return pages in these namespaces only.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
rnfilterredir

How to filter for redirects.

One of the following values: all, nonredirects, redirects
Default: nonredirects
rnminsize

Limit to pages with at least this many bytes.

Type: integer
rnmaxsize

Limit to pages with at most this many bytes.

Type: integer
rncontentmodel

Filter pages that have the specified content model.

One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
rnredirect
Deprecated.

Use rnfilterredir=redirects instead.

Type: boolean (details)
rnlimit

Limit how many random pages will be returned.

Type: integer or max
The value must be between 1 and 500.
Default: 1
rncontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Return two random pages from the main namespace.
api.php?action=query&list=random&rnnamespace=0&rnlimit=2 [open in sandbox]
Return page info about two random pages from the main namespace.
api.php?action=query&generator=random&grnnamespace=0&grnlimit=2&prop=info [open in sandbox]
Return page info about one random page from the main namespace that has at least 500 bytes of text.
api.php?action=query&list=random&rnnamespace=0&rnlimit=1&minsize=500 [open in sandbox]

list=recentchanges (rc)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate recent changes.

Specific parameters:
Other general parameters are available.
rcstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
rcend

The timestamp to end enumerating.

Type: timestamp (allowed formats)
rcdir

In which direction to enumerate:

newer
List oldest first. Note: rcstart has to be before rcend.
older
List newest first (default). Note: rcstart has to be later than rcend.
One of the following values: newer, older
Default: older
rcnamespace

Filter changes to only these namespaces.

Values (separate with | or alternative): -1, -2, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
rcuser

Only list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rcexcludeuser

Don't list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
rctag

Only list changes tagged with this tag.

rcprop

Include additional pieces of information:

user
Adds the user responsible for the edit and tags if they are an IP. If the user has been revision deleted, a userhidden property will be returned.
userid
Adds the user ID responsible for the edit. If the user has been revision deleted, a userhidden property will be returned.
comment
Adds the comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds the parsed comment for the edit. If the comment has been revision deleted, a commenthidden property will be returned.
flags
Adds flags for the edit.
timestamp
Adds timestamp of the edit.
title
Adds the page title of the edit.
ids
Adds the page ID, recent changes ID and the new and old revision ID.
sizes
Adds the new and old page length in bytes.
redirect
Tags edit if page is a redirect.
patrolled
Tags patrollable edits as being patrolled or unpatrolled.
loginfo
Adds log information (log ID, log type, etc) to log entries.
tags
Lists tags for the entry.
sha1
Adds the content checksum for entries associated with a revision. If the content has been revision deleted, a sha1hidden property will be returned.
Values (separate with | or alternative): comment, flags, ids, loginfo, parsedcomment, patrolled, redirect, sha1, sizes, tags, timestamp, title, user, userid
Default: title|timestamp|ids
rcshow

Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set rcshow=minor|!anon.

Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !redirect, anon, autopatrolled, bot, minor, patrolled, redirect, unpatrolled
rclimit

How many total changes to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
rctype

Which types of changes to show.

Values (separate with | or alternative): categorize, edit, external, log, new
Default: edit|new|log|categorize
rctoponly

Only list changes which are the latest revision.

Type: boolean (details)
rctitle

Filter entries to those related to a page.

rccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

rcgeneraterevisions

When being used as a generator, generate revision IDs rather than titles. Recent change entries without associated revision IDs (e.g. most log entries) will generate nothing.

Type: boolean (details)
rcslot

Only list changes that touch the named slot.

One of the following values: main

list=search (sr)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Perform a full text search.

Specific parameters:
Other general parameters are available.
srsearch

Search for page titles or content matching this value. You can use the search string to invoke special search features, depending on what the wiki's search backend implements.

This parameter is required.
srnamespace

Search only within these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
Default: 0
srlimit

How many total pages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
sroffset

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Type: integer
The value must be no less than 0.
Default: 0
srqiprofile

Query independent profile to use (affects ranking algorithm).

classic
Ranking based on the number of incoming links, some templates, page language and recency (templates/language/recency may not be activated on this wiki).
classic_noboostlinks
Ranking based on some templates, page language and recency when activated on this wiki.
empty
Ranking based solely on query dependent features (for debug only).
wsum_inclinks
Weighted sum based on incoming links
wsum_inclinks_pv
Weighted sum based on incoming links and weekly pageviews
popular_inclinks_pv
Ranking based primarily on page views
popular_inclinks
Ranking based primarily on incoming link counts
engine_autoselect
Let the search engine decide on the best profile to use.
One of the following values: classic, classic_noboostlinks, empty, engine_autoselect, popular_inclinks, popular_inclinks_pv, wsum_inclinks, wsum_inclinks_pv
Default: engine_autoselect
srqdprofile

Query dependent profile to use (affects ranking algorithm).

default
(no description)
perfield_builder
(no description)
perfield_builder_relaxed
(no description)
perfield_builder_title_filter
(no description)
engine_autoselect
Let the search engine decide on the best profile to use.
One of the following values: default, engine_autoselect, perfield_builder, perfield_builder_relaxed, perfield_builder_title_filter
Default: engine_autoselect
srwhat

Which type of search to perform.

One of the following values: nearmatch, text, title
srinfo

Which metadata to return.

Values (separate with | or alternative): rewrittenquery, suggestion, totalhits
Default: totalhits|suggestion|rewrittenquery
srprop

Which properties to return:

size
Adds the size of the page in bytes.
wordcount
Adds the word count of the page.
timestamp
Adds the timestamp of when the page was last edited.
snippet
Adds a snippet of the page, with query term highlighting markup.
titlesnippet
Adds the page title, with query term highlighting markup.
redirecttitle
Adds the title of the matching redirect.
redirectsnippet
Adds the title of the matching redirect, with query term highlighting markup.
sectiontitle
Adds the title of the matching section.
sectionsnippet
Adds the title of the matching section, with query term highlighting markup.
isfilematch
Adds a boolean indicating if the search matched file content.
categorysnippet
Adds the matching category name, with query term highlighting markup.
score
Deprecated. Ignored.
hasrelated
Deprecated. Ignored.
extensiondata
Adds extra data generated by extensions.
Values (separate with | or alternative): categorysnippet, extensiondata, isfilematch, redirectsnippet, redirecttitle, sectionsnippet, sectiontitle, size, snippet, timestamp, titlesnippet, wordcount, hasrelated, score
Default: size|wordcount|timestamp|snippet
srinterwiki

Include interwiki results in the search, if available.

Type: boolean (details)
srenablerewrites

Enable internal query rewriting. Some search backends can rewrite the query into another which is thought to provide better results, for instance by correcting spelling errors.

Type: boolean (details)
srsort

Set the sort order of returned results.

One of the following values: create_timestamp_asc, create_timestamp_desc, incoming_links_asc, incoming_links_desc, just_match, last_edit_asc, last_edit_desc, none, random, relevance, user_random
Default: relevance

list=tags (tg)

List change tags.

Specific parameters:
Other general parameters are available.
tgcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tglimit

The maximum number of tags to list.

Type: integer or max
The value must be between 1 and 500.
Default: 10
tgprop

Which properties to get:

displayname
Adds the displayed name of the tag. This property will be omitted for hidden tags.
description
Adds the description of the tag.
hitcount
Adds the number of revisions and log entries that have this tag.
defined
Indicate whether the tag is defined (see source).
source
Gets the sources of the tag definition, which may include software for software-defined tags and manual for tags that may be applied manually by users.
active
Whether the tag is still being applied by the software, or may still be applied by users.
Values (separate with | or alternative): active, defined, description, displayname, hitcount, source
Default: (empty)

list=trackingcategories (tc)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.

Specific parameters:
Other general parameters are available.
tccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

tctrackingcatname

Search for all existing tracking category titles that match the provided tracking category name (as defined by "message name" on Special:TrackingCategories.)

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
tcmin

Only return existing tracking categories with at least this many members.

Type: integer
tcmax

Only return existing tracking categories with at most this many members.

Type: integer
tclimit

How many tracking categories to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
tcprop

Which properties to get:

size
Adds number of pages in the tracking category.
hidden
Tags tracking categories that are hidden with __HIDDENCAT__.
Values (separate with | or alternative): hidden, size
Default: (empty)
Examples:
List tracking categories with information on the number of pages in each.
api.php?action=query&list=trackingcategories&tcprop=size [open in sandbox]
Retrieve info about the tracking category pages representing the broken-file-category themselves, if they exist
api.php?action=query&generator=trackingcategories&gtctrackingcatname=broken-file-category&prop=info [open in sandbox]

list=usercontribs (uc)

Get all edits by a user.

Specific parameters:
Other general parameters are available.
uclimit

The maximum number of contributions to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
ucstart

The start timestamp to return from, i.e. revisions before this timestamp.

Type: timestamp (allowed formats)
ucend

The end timestamp to return to, i.e. revisions after this timestamp.

Type: timestamp (allowed formats)
uccontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

ucuser

The users to retrieve contributions for. Cannot be used with ucuserids, ucuserprefix, or uciprange.

Type: list of users, by any of username, IP, Temporary user and interwiki name (e.g. "prefix>ExampleName")
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ucuserids

The user IDs to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or uciprange.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ucuserprefix

Retrieve contributions for all users whose names begin with this value. Cannot be used with ucuser, ucuserids, or uciprange.

uciprange

The CIDR range to retrieve contributions for. Cannot be used with ucuser, ucuserprefix, or ucuserids.

ucdir

In which direction to enumerate:

newer
List oldest first. Note: ucstart has to be before ucend.
older
List newest first (default). Note: ucstart has to be later than ucend.
One of the following values: newer, older
Default: older
ucnamespace

Only list contributions in these namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
ucprop

Include additional pieces of information:

ids
Adds the page ID and revision ID.
title
Adds the title and namespace ID of the page.
timestamp
Adds the timestamp of the edit.
comment
Adds the comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds the parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
size
Adds the new size of the edit.
sizediff
Adds the size delta of the edit against its parent.
flags
Adds flags of the edit.
patrolled
Tags patrolled edits.
tags
Lists tags for the edit.
Values (separate with | or alternative): comment, flags, ids, parsedcomment, patrolled, size, sizediff, tags, timestamp, title
Default: ids|title|timestamp|comment|size|flags
ucshow

Show only items that meet these criteria, e.g. non minor edits only: ucshow=!minor.

If ucshow=patrolled or ucshow=!patrolled is set, revisions older than $wgRCMaxAge (7776000 seconds) won't be shown.

Values (separate with | or alternative): !autopatrolled, !minor, !new, !patrolled, !top, autopatrolled, minor, new, patrolled, top
uctag

Only list revisions tagged with this tag.

uctoponly
Deprecated.

Only list changes which are the latest revision.

Type: boolean (details)
Examples:
Show contributions of user Example.
api.php?action=query&list=usercontribs&ucuser=Example [open in sandbox]
Show contributions from all IP addresses with prefix 192.0.2..
api.php?action=query&list=usercontribs&ucuserprefix=192.0.2. [open in sandbox]

list=users (us)

Get information about a list of users.

Specific parameters:
Other general parameters are available.
usprop

Which pieces of information to include:

blockinfo
Tags if the user is blocked, by whom, and for what reason.
groups
Lists all the groups each user belongs to.
groupmemberships
Lists groups that each user has been explicitly assigned to, including the expiry date of each group membership.
implicitgroups
Lists all the groups a user is automatically a member of.
rights
Lists all the rights each user has.
editcount
Adds the user's edit count.
registration
Adds the user's registration timestamp.
emailable
Tags if the user can and wants to receive email through Special:Emailuser.
gender
Tags the gender of the user. Returns "male", "female", or "unknown".
centralids
Adds the central IDs and attachment status for the user.
cancreate
Indicates whether an account for valid but unregistered usernames can be created. To check whether the current user can perform the account creation, use action=query&meta=userinfo&uiprop=cancreateaccount.
tempexpired
Indicates whether the temporary account has expired or not. If account isn't temporary, null is returned.
Values (separate with | or alternative): blockinfo, cancreate, centralids, editcount, emailable, gender, groupmemberships, groups, implicitgroups, registration, rights, tempexpired
usattachedwiki

With usprop=centralids, indicate whether the user is attached with the wiki identified by this ID.

ususers

A list of users to obtain information for.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
ususerids

A list of user IDs to obtain information for.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

list=watchlist (wl)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get recent changes to pages in the current user's watchlist.

Specific parameters:
Other general parameters are available.
wlallrev

Include multiple revisions of the same page within given timeframe.

Type: boolean (details)
wlstart

The timestamp to start enumerating from.

Type: timestamp (allowed formats)
wlend

The timestamp to end enumerating.

Type: timestamp (allowed formats)
wlnamespace

Filter changes to only the given namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
wluser

Only list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
wlexcludeuser

Don't list changes by this user.

Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
wldir

In which direction to enumerate:

newer
List oldest first. Note: wlstart has to be before wlend.
older
List newest first (default). Note: wlstart has to be later than wlend.
One of the following values: newer, older
Default: older
wllimit

How many total results to return per request.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wlprop

Which additional properties to get:

ids
Adds revision IDs and page IDs.
title
Adds title of the page.
flags
Adds flags for the edit.
user
Adds the user who made the edit. If the user has been revision deleted, a userhidden property will be returned.
userid
Adds user ID of whoever made the edit. If the user has been revision deleted, a userhidden property will be returned.
comment
Adds comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
parsedcomment
Adds parsed comment of the edit. If the comment has been revision deleted, a commenthidden property will be returned.
timestamp
Adds timestamp of the edit.
patrol
Tags edits that are patrolled.
sizes
Adds the old and new lengths of the page.
notificationtimestamp
Adds timestamp of when the user was last notified about the edit.
loginfo
Adds log information where appropriate.
tags
Lists tags for the entry.
expiry
Adds the expiry time.
labels
Adds watchlist labels associated with the entry.
Values (separate with | or alternative): comment, expiry, flags, ids, labels, loginfo, notificationtimestamp, parsedcomment, patrol, sizes, tags, timestamp, title, user, userid
Default: ids|title|flags
wlshow

Show only items that meet these criteria. For example, to see only minor edits done by logged-in users, set wlshow=minor|!anon.

Values (separate with | or alternative): !anon, !autopatrolled, !bot, !minor, !patrolled, !unread, anon, autopatrolled, bot, minor, patrolled, unread
wltype

Which types of changes to show:

edit
Regular page edits.
new
Page creations.
log
Log entries.
external
External changes.
categorize
Category membership changes.
Values (separate with | or alternative): categorize, edit, external, log, new
Default: edit|new|log|categorize
wllabels

Only list changes with these watchlist label IDs.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wlowner

Used along with wltoken to access a different user's watchlist.

Type: user, by username
wltoken

A security token (available in the user's preferences) to allow access to another user's watchlist.

wlcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
List the top revision for recently changed pages on the current user's watchlist.
api.php?action=query&list=watchlist [open in sandbox]
Fetch additional information about the top revision for recently changed pages on the current user's watchlist.
api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment [open in sandbox]
Fetch additional information about the top revision for recently changed pages on the current user's watchlist, including when temporarily watched items will expire.
api.php?action=query&list=watchlist&wlprop=ids|title|timestamp|user|comment|expiry [open in sandbox]
Fetch information about all recent changes to pages on the current user's watchlist.
api.php?action=query&list=watchlist&wlallrev=&wlprop=ids|title|timestamp|user|comment [open in sandbox]
Fetch page info for recently changed pages on the current user's watchlist.
api.php?action=query&generator=watchlist&prop=info [open in sandbox]
Fetch revision info for recent changes to pages on the current user's watchlist.
api.php?action=query&generator=watchlist&gwlallrev=&prop=revisions&rvprop=timestamp|user [open in sandbox]
List the top revision for recently changed pages on the watchlist of user Example.
api.php?action=query&list=watchlist&wlowner=Example&wltoken=123ABC [open in sandbox]

list=watchlistraw (wr)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Get all pages on the current user's watchlist.

Specific parameters:
Other general parameters are available.
wrcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

wrnamespace

Only list pages in the given namespaces.

Values (separate with | or alternative): 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 120, 121, 122, 123, 828, 829
To specify all values, use *.
wrlimit

How many total results to return per request.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wrprop

Which additional properties to get:

changed
Adds timestamp of when the user was last notified about the edit.
Values (separate with | or alternative): changed
wrshow

Only list items that meet these criteria.

Values (separate with | or alternative): !changed, changed
wrowner

Used along with wrtoken to access a different user's watchlist.

Type: user, by username
wrtoken

A security token (available in the user's preferences) to allow access to another user's watchlist.

wrdir

The direction in which to list.

One of the following values: ascending, descending
Default: ascending
wrfromtitle

Title (with namespace prefix) to begin enumerating from.

wrtotitle

Title (with namespace prefix) to stop enumerating at.

Examples:
List pages on the current user's watchlist.
api.php?action=query&list=watchlistraw [open in sandbox]
Fetch page info for pages on the current user's watchlist.
api.php?action=query&generator=watchlistraw&gwrshow=changed&prop=info [open in sandbox]

list=wblistentityusage (wbleu)

  • This module requires read rights.
  • This module can be used as a generator.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Returns all pages that use the given entity IDs.

Specific parameters:
Other general parameters are available.
wbleuprop

Properties to add to the result.

url
If enabled the url of the entity will be added to the result.
Values (separate with | or alternative): url
wbleuaspect

Only return entity IDs that used this aspect.

S
The entity's sitelinks are used
L
The entity's label is used
D
The entity's description is used
T
The title of the local page corresponding to the entity is used
C
Statements from the entity are used
X
All aspects of an entity are or may be used
O
Something else about the entity is used. This currently implies alias usage and explicit checks for entity existence.
Values (separate with | or alternative): C, D, L, O, S, T, X
wbleuentities

Entities that have been used.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wbleulimit

How many entity usages to return.

Type: integer or max
The value must be between 1 and 500.
Default: 10
wbleucontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

list=wbsearch (wbs)

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module can be used as a generator.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Searches for entities using labels and aliases.

This can be used as a generator for other queries. Returns the matched term that should be displayed.

Specific parameters:
Other general parameters are available.
wbssearch

Search for this text.

This parameter is required.
wbslanguage

Search in this language.

One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
wbsstrictlanguage

Whether to disable language fallback

Type: boolean (details)
wbstype

Search for this type of entity.

One of the following values: item, property
Default: item
wbslimit

Maximal number of results

Type: integer or max
The value must be between 0 and 50.
Default: 7
wbsprofile

The search profile to use.

default
The default profile, suitable for most purposes.
One of the following values: default
Default: default
Examples:
Search for "abc" in English language, with defaults for type and limit
api.php?action=query&list=wbsearch&wbssearch=abc&wbslanguage=en [open in sandbox]
Search for "abc" in English language with a limit of 50
api.php?action=query&list=wbsearch&wbssearch=abc&wbslanguage=en&wbslimit=50 [open in sandbox]
Search only properties for "alphabet" in English language
api.php?action=query&list=wbsearch&wbssearch=alphabet&wbslanguage=en&wbstype=property [open in sandbox]
Search for "alphabet" in English language as a generator
api.php?action=query&generator=wbsearch&gwbssearch=alphabet&gwbslanguage=en [open in sandbox]

list=wbsubscribers (wbls)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get subscriptions to given entities.

Specific parameters:
Other general parameters are available.
wblsentities

Entities to get subscribers

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
wblsprop

Properties to add to result

Values (separate with | or alternative): url
Default: (empty)
wblslimit

Maximal number of results

Type: integer or max
The value must be between 1 and 500.
Default: 10
wblscontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Get subscribers to entity Q42
api.php?action=query&list=wbsubscribers&wblsentities=Q42 [open in sandbox]
Get subscribers to entity Q42 with URL to Special:EntityUsage included
api.php?action=query&list=wbsubscribers&wblsentities=Q42&wblsprop=url [open in sandbox]

meta=allmessages (am)

Return messages from this site.

Specific parameters:
Other general parameters are available.
ammessages

Which messages to output. * (default) means all messages.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: *
amprop

Which properties to get.

Values (separate with | or alternative): default
amenableparser

Set to enable parser, will preprocess the wikitext of message (substitute magic words, handle templates, etc.).

Type: boolean (details)
amnocontent

If set, do not include the content of the messages in the output.

Type: boolean (details)
amincludelocal

Also include local messages, i.e. messages that don't exist in the software but do exist as in the MediaWiki namespace. This lists all MediaWiki-namespace pages, so it will also list those that aren't really messages such as Common.js.

Type: boolean (details)
amargs

Arguments to be substituted into message.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
amfilter

Return only messages with names that contain this string.

amcustomised

Return only messages in this customisation state.

One of the following values: all, modified, unmodified
Default: all
amlang

Return messages in this language.

amfrom

Return messages starting at this message.

amto

Return messages ending at this message.

amtitle

Page name to use as context when parsing message (for amenableparser option).

amprefix

Return messages with this prefix.

meta=authmanagerinfo (ami)

Retrieve information about the current authentication status.

Specific parameters:
Other general parameters are available.
amisecuritysensitiveoperation

Test whether the user's current authentication status is sufficient for the specified security-sensitive operation.

amirequestsfor

Fetch information about the authentication requests needed for the specified authentication action.

One of the following values: change, create, create-continue, link, link-continue, login, login-continue, remove, unlink
amimergerequestfields

Merge field information for all authentication requests into one array.

Type: boolean (details)
amimessageformat

Format to use for returning messages.

One of the following values: html, none, raw, wikitext
Default: wikitext
Examples:
Fetch the requests that may be used when beginning a login.
api.php?action=query&meta=authmanagerinfo&amirequestsfor=login [open in sandbox]
Fetch the requests that may be used when beginning a login, with form fields merged.
api.php?action=query&meta=authmanagerinfo&amirequestsfor=login&amimergerequestfields=1 [open in sandbox]
Test whether authentication is sufficient for action foo.
api.php?action=query&meta=authmanagerinfo&amisecuritysensitiveoperation=foo [open in sandbox]

meta=checkuserformattedblockinfo

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: CheckUser
  • License: GPL-2.0-or-later

Return formatted block details for sitewide blocks affecting the current user.

meta=filerepoinfo (fri)

Return meta information about image repositories configured on the wiki.

Specific parameter:
Other general parameters are available.
friprop

Which repository properties to get (properties available may vary on other wikis).

canUpload
Whether files can be uploaded to this repository, e.g. via CORS and shared authentication.
displayname
The human-readable name of the repository wiki.
favicon
Repository wiki's favicon URL, from $wgFavicon.
initialCapital
Whether file names implicitly start with a capital letter.
local
Whether that repository is the local one or not.
name
The key of the repository - used in e.g. $wgForeignFileRepos and imageinfo return values.
rootUrl
Root URL path for image paths.
scriptDirUrl
Root URL path for the repository wiki's MediaWiki installation.
thumbUrl
Root URL path for thumbnail paths.
url
Public zone URL path.
Values (separate with | or alternative): canUpload, displayname, favicon, initialCapital, local, name, rootUrl, scriptDirUrl, thumbUrl, url
Default: canUpload|displayname|favicon|initialCapital|local|name|rootUrl|scriptDirUrl|thumbUrl|url

meta=languageinfo (li)

Return information about available languages.

Continuation may be applied if retrieving the information takes too long for one request.

Specific parameters:
Other general parameters are available.
liprop

Which information to get for each language.

code
The language code. (This code is MediaWiki-specific, though there are overlaps with other standards.)
bcp47
The BCP-47 language code.
dir
The writing direction of the language (either ltr or rtl).
autonym
The autonym of the language, that is, the name in that language.
name
The name of the language in the language specified by the uselang parameter, with language fallbacks applied if necessary.
variantnames
The short names for language variants used for language conversion links.
fallbacks
The language codes of the fallback languages configured for this language. The implicit final fallback to 'en' is not included (but some languages may fall back to 'en' explicitly).
variants
The language codes of the variants supported by this language.
Values (separate with | or alternative): autonym, bcp47, code, dir, fallbacks, name, variantnames, variants
Default: code
licode

Language codes of the languages that should be returned, or * for all languages.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: *
licontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

Examples:
Get the language codes of all supported languages.
api.php?action=query&meta=languageinfo [open in sandbox]
Get the autonyms and German names of all supported languages.
api.php?action=query&meta=languageinfo&liprop=autonym|name&uselang=de [open in sandbox]
Get the fallback languages and variants of Occitan.
api.php?action=query&meta=languageinfo&liprop=fallbacks|variants&licode=oc [open in sandbox]
Get the BCP-47 language code and direction of all supported languages.
api.php?action=query&meta=languageinfo&liprop=bcp47|dir [open in sandbox]

meta=linterstats (lntrst)

Get number of lint errors in each category

Example:
Get number of lint errors in each category
api.php?action=query&meta=linterstats [open in sandbox]

meta=notifications (not)

  • This module requires read rights.
  • Source: Echo
  • License: MIT

Get notifications waiting for the current user.

Specific parameters:
Other general parameters are available.
notfilter

Filter notifications returned.

Values (separate with | or alternative): !read, read
Default: read|!read
notprop

Details to request.

Values (separate with | or alternative): count, list, seenTime
Default: list
notsections

The notification sections to query (i.e. some combination of 'alert' and 'message').

Values (separate with | or alternative): alert, message
Default: alert|message
notgroupbysection

Whether to group the result by section. Each section is fetched separately if set.

Type: boolean (details)
notformat

If specified, notifications will be returned formatted this way.

model
Raw notification data
special
Formatted for Special:Notifications page (and only that!) Do not rely on the HTML as it may change at any given time.
flyout
Deprecated. Use notformat=model for raw data
html
Deprecated. Use notformat=model for raw data
One of the following values: flyout, html, model, special
notlimit

The maximum number of notifications to return.

Type: integer or max
The value must be between 1 and 50.
Default: 20
notcontinue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

notunreadfirst

Whether to show unread notifications first (only used if groupbysection is not set).

Type: boolean (details)
nottitles

Only return notifications for these pages. To get notifications not associated with any page, use [] as a title.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
notbundle

Whether to show bundle compatible unread notifications according to notification types bundling rules.

Type: boolean (details)
notnotifiertypes

Notifier types for which to return notifications.

Values (separate with | or alternative): email, web
Default: web
notalertcontinue

When more alert results are available, use this to continue.

notalertunreadfirst

Whether to show unread message notifications first (only used if groupbysection is set).

Type: boolean (details)
notmessagecontinue

When more message results are available, use this to continue.

notmessageunreadfirst

Whether to show unread alert notifications first (only used if groupbysection is set).

Type: boolean (details)

meta=siteinfo (si)

Return general information about the site.

Specific parameters:
Other general parameters are available.
siprop

Which information to get:

general
Overall system information.
namespaces
List of registered namespaces and their canonical names.
namespacealiases
List of registered namespace aliases.
specialpagealiases
List of special page aliases.
magicwords
List of magic words and their aliases.
interwikimap
Returns interwiki map (optionally filtered, optionally localised by using siinlanguagecode).
dbrepllag
Returns database server with the highest replication lag.
statistics
Returns site statistics.
usergroups
Returns user groups and the associated permissions.
autocreatetempuser
Returns configuration for the automatic creation of temporary user accounts (also known as IP masking).
clientlibraries
Returns client-side libraries installed on the wiki
libraries
Returns libraries installed on the wiki.
extensions
Returns extensions installed on the wiki.
fileextensions
Returns list of file extensions (file types) allowed to be uploaded.
rightsinfo
Returns wiki rights (license) information if available.
restrictions
Returns information on available restriction (protection) types.
languages
Returns a list of languages MediaWiki supports (optionally localised by using siinlanguagecode).
languagevariants
Returns a list of language codes for which LanguageConverter is enabled, and the variants supported for each.
skins
Returns a list of all enabled skins (optionally localised by using siinlanguagecode, otherwise in the content language).
extensiontags
Returns a list of parser extension tags.
functionhooks
Returns a list of magic word IDs for parser functions.
showhooks
Returns a list of all subscribed hooks (contents of $wgHooks).
variables
Returns a list of magic word IDs for magic variables.
doubleunderscores
Returns a list of magic word IDs for behavior switches.
protocols
Returns a list of protocols that are allowed in external links.
defaultoptions
Returns the default values for user preferences.
uploaddialog
Returns the upload dialog configuration.
autopromote
Returns the automatic promotion configuration.
autopromoteonce
Returns the automatic promotion configuration that are only done once.
copyuploaddomains
Returns the list of allowed copy upload domains
sbom
Returns a Software Bill of Materials (SBOM) for the MediaWiki installation in the CycloneDX 1.6 format.
Values (separate with | or alternative): autocreatetempuser, autopromote, autopromoteonce, clientlibraries, copyuploaddomains, dbrepllag, defaultoptions, doubleunderscores, extensions, extensiontags, fileextensions, functionhooks, general, interwikimap, languages, languagevariants, libraries, magicwords, namespacealiases, namespaces, protocols, restrictions, rightsinfo, sbom, showhooks, skins, specialpagealiases, statistics, uploaddialog, usergroups, variables
Default: general
sifilteriw

Return only local or only nonlocal entries of the interwiki map.

One of the following values: !local, local
sishowalldb

List all database servers, not just the one lagging the most.

Type: boolean (details)
sinumberingroup

Lists the number of users in user groups.

Type: boolean (details)
siinlanguagecode

Language code for localised language names (best effort) and skin names.

meta=tokens

Gets tokens for data-modifying actions.

Specific parameter:
Other general parameters are available.
type

Types of token to request.

Values (separate with | or alternative): createaccount, csrf, login, patrol, rollback, userrights, watch
To specify all values, use *.
Default: csrf
Examples:
Retrieve a csrf token (the default).
api.php?action=query&meta=tokens [open in sandbox]
Retrieve a watch token and a patrol token.
api.php?action=query&meta=tokens&type=watch|patrol [open in sandbox]

meta=unreadnotificationpages (unp)

  • This module requires read rights.
  • Source: Echo
  • License: MIT

Get pages for which there are unread notifications for the current user.

Specific parameters:
Other general parameters are available.
unpgrouppages

Group talk pages together with their subject page, and group notifications not associated with a page together with the current user's user page.

Type: boolean (details)
unplimit

The maximum number of pages to return.

Type: integer or max
The value must be between 1 and 10,000.
Default: 10
Example:
List pages with (their amount of) unread notifications
api.php?action=query&meta=unreadnotificationpages [open in sandbox]

meta=userinfo (ui)

Get information about the current user.

Specific parameters:
Other general parameters are available.
uiprop

Which pieces of information to include:

blockinfo
Tags if the current user is blocked, by whom, and for what reason.
hasmsg
Adds a tag messages if the current user has pending messages.
groups
Lists all the groups the current user belongs to.
groupmemberships
Lists groups that the current user has been explicitly assigned to, including the expiry date of each group membership.
implicitgroups
Lists all the groups the current user is automatically a member of.
rights
Lists all the rights the current user has.
changeablegroups
Lists the groups the current user can add to and remove from.
options
Lists all preferences the current user has set.
editcount
Adds the current user's edit count.
ratelimits
Lists all rate limits applying to the current user.
theoreticalratelimits
Lists all rate limits that would apply to the current user if they were not exempt from all ratelimits based on user rights or ip.
email
Adds the user's email address and email authentication date.
realname
Adds the user's real name.
acceptlang
Echoes the Accept-Language header sent by the client in a structured format.
registrationdate
Adds the user's registration date.
unreadcount
Adds the count of unread pages on the user's watchlist (maximum 999; returns 1000+ if more).
watchlistlabels
Adds watchlist labels the user has set up.
centralids
Adds the central IDs and attachment status for the user.
latestcontrib
Adds the date of user's latest contribution.
cancreateaccount
Indicates whether the user is allowed to create accounts. To check whether some specific account can be created, use action=query&list=users&usprop=cancreate.
Values (separate with | or alternative): acceptlang, blockinfo, cancreateaccount, centralids, changeablegroups, editcount, email, groupmemberships, groups, hasmsg, implicitgroups, latestcontrib, options, ratelimits, realname, registrationdate, rights, theoreticalratelimits, unreadcount, watchlistlabels
To specify all values, use *.
uiattachedwiki

With uiprop=centralids, indicate whether the user is attached with the wiki identified by this ID.

Examples:
Get information about the current user.
api.php?action=query&meta=userinfo [open in sandbox]
Get additional information about the current user.
api.php?action=query&meta=userinfo&uiprop=blockinfo|groups|rights|hasmsg [open in sandbox]

meta=wbcontentlanguages (wbcl)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Returns information about the content languages Wikibase accepts in different contexts.

Specific parameters:
Other general parameters are available.
wbclcontext

The context in which the content languages should be valid.

term
The terms (label, description, aliases) of an entity.
monolingualtext
A monolingual text value in a statement.
One of the following values: monolingualtext, term
Default: term
wbclprop

The properties that should be returned about each language.

code
The language code.
autonym
The autonym of the language, that is, the name of the language in that language. May not be known for all languages.
name
The name of the language in the current language (specified via the uselang parameter), with language fallbacks applied if necessary. Usually, at least an English name is known for all content languages Wikibase accepts.
Values (separate with | or alternative): autonym, code, name
Default: code
Examples:
Get the valid language codes for the terms of an entity.
api.php?action=query&meta=wbcontentlanguages [open in sandbox]
Get the valid languages, with language code and autonym, for monolingual text values.
api.php?action=query&meta=wbcontentlanguages&wbclcontext=monolingualtext&wbclprop=code|autonym [open in sandbox]

meta=wikibase (wb)

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Get information about the Wikibase client and the associated Wikibase repository.

Specific parameter:
Other general parameters are available.
wbprop

Which properties to get:

url
Base URL, script path and article path of the Wikibase repository.
siteid
The siteid of this site.
Values (separate with | or alternative): siteid, url
Default: url|siteid
Example:
Get URL path and other information about Wikibase client and repository.
api.php?action=query&meta=wikibase [open in sandbox]

action=removeauthenticationdata

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Remove authentication data for the current user.

Specific parameters:
Other general parameters are available.
request

Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=remove.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Attempt to remove the current user's data for FooAuthenticationRequest.
api.php?action=removeauthenticationdata&request=FooAuthenticationRequest&token=123ABC [open in sandbox]

action=resetpassword

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Send a password reset email to a user.

Specific parameters:
Other general parameters are available.
user

User being reset.

Type: user, by username
email

Email address of the user being reset.

token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Send a password reset email to user Example.
api.php?action=resetpassword&user=Example&token=123ABC [open in sandbox]
Send a password reset email for all users with email address user@example.com.
api.php?action=resetpassword&user=user@example.com&token=123ABC [open in sandbox]

action=revisiondelete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Delete and undelete revisions.

Specific parameters:
Other general parameters are available.
type

Type of revision deletion being performed.

This parameter is required.
One of the following values: archive, filearchive, logging, oldimage, revision
target

Page title for the revision deletion, if required for the type.

ids

Identifiers for the revisions to be deleted.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
hide

What to hide for each revision.

Values (separate with | or alternative): comment, content, user
show

What to unhide for each revision.

Values (separate with | or alternative): comment, content, user
suppress

Whether to suppress data from administrators as well as others.

One of the following values: no, nochange, yes
Default: nochange
reason

Reason for the deletion or undeletion.

tags

Tags to apply to the entry in the deletion log.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=rollback

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Undo the last edit to the page.

If the last user who edited the page made multiple edits in a row, they will all be rolled back.

Specific parameters:
Other general parameters are available.
title

Title of the page to roll back. Cannot be used together with pageid.

pageid

Page ID of the page to roll back. Cannot be used together with title.

Type: integer
tags

Tags to apply to the rollback.

Values (separate with | or alternative):
user

Name of the user whose edits are to be rolled back.

This parameter is required.
Type: user, by any of username, IP, Temporary user, interwiki name (e.g. "prefix>ExampleName") and user ID (e.g. "#12345")
summary

Custom edit summary. If empty, default summary will be used.

Default: (empty)
markbot

Mark the reverted edits and the revert as bot edits.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
token

A "rollback" token retrieved from action=query&meta=tokens

For compatibility, the token used in the web UI is also accepted.

This parameter is required.
Examples:
Roll back the last edits to page Main Page by user Example.
api.php?action=rollback&title=Main%20Page&user=Example&token=123ABC [open in sandbox]
Roll back the last edits to page Main Page by IP user 192.0.2.5 with summary Reverting vandalism, and mark those edits and the revert as bot edits.
api.php?action=rollback&title=Main%20Page&user=192.0.2.5&token=123ABC&summary=Reverting%20vandalism&markbot=1 [open in sandbox]

action=rsd

(main | rsd)

Export an RSD (Really Simple Discovery) schema.

Example:
Export the RSD schema.
api.php?action=rsd [open in sandbox]

action=scribunto-console

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: Scribunto
  • License: GPL-2.0-or-later AND MIT

Internal module for servicing XHR requests from the Scribunto console.

Specific parameters:
Other general parameters are available.
title

The title of the module to test.

content

The new content of the module.

session

Session token.

Type: integer
question

The next line to evaluate as a script.

This parameter is required.
clear

Set to clear the current session state.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=setnotificationtimestamp

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Update the notification timestamp for watched pages.

This affects the highlighting of changed pages in the watchlist and history, and the sending of email when the "Email me when a page or a file on my watchlist is changed" preference is enabled.

Specific parameters:
Other general parameters are available.
entirewatchlist

Work on all watched pages.

Type: boolean (details)
timestamp

Timestamp to which to set the notification timestamp.

Type: timestamp (allowed formats)
torevid

Revision to set the notification timestamp to (one page only).

Type: integer
newerthanrevid

Revision to set the notification timestamp newer than (one page only).

Type: integer
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsearch
Internal. Searches for entities using labels and aliases.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=setpagelanguage

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change the language of a page.

Changing the language of a page is not allowed on this wiki.

Enable $wgPageLanguageUseDB to use this action.

Specific parameters:
Other general parameters are available.
title

Title of the page whose language you wish to change. Cannot be used together with pageid.

pageid

Page ID of the page whose language you wish to change. Cannot be used together with title.

Type: integer
lang

Language code of the language to change the page to. Use default to reset the page to the wiki's default content language.

This parameter is required.
One of the following values: aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, aig, aln, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, ban, ban-bali, bar, bbc, bbc-latn, bcc, bci, bcl, bdr, be, be-tarask, bew, bg, bgc, bgn, bh, bho, bi, bjn, blk, bm, bn, bo, bol, bpy, bqi, br, brh, bs, btm, bto, bug, bug-bugi, bxr, ca, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, chr, chy, ckb, co, cop, cps, cpx, cpx-hans, cpx-hant, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, default, dga, din, diq, dlg, dsb, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, eo, es, es-formal, et, eu, ext, fa, fat, ff, fi, fit, fj, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, kg, kge, khw, ki, kiu, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mdf, mg, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mui, mwl, my, myv, mzn, nah, nan, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, nia, nit, niu, nl, nl-informal, nmz, nn, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, qug, rgn, rif, rki, rm, rmc, rmy, rn, ro, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shn, shy, shy-latn, si, sjd, sje, sk, skr, skr-arab, sl, sli, sm, sma, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, ss, st, stq, sty, su, sv, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, ti, tig, tk, tl, tly, tn, to, tok, tpi, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, wa, wal, war, wls, wlx, wo, wuu, wuu-hans, wuu-hant, xal, xh, xmf, xsy, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zh, zh-cn, zh-hans, zh-hant, zh-hk, zh-mo, zh-my, zh-sg, zh-tw, zu
reason

Reason for the change.

tags

Change tags to apply to the log entry resulting from this action.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Change the language of the page Main Page to Basque.
api.php?action=setpagelanguage&title=Main%20Page&lang=eu&token=123ABC [open in sandbox]
Change the language of the page with ID 123 to the wiki's default content language.
api.php?action=setpagelanguage&pageid=123&lang=default&token=123ABC [open in sandbox]

action=spamblacklist

Validate one or more URLs against the spam block list.

Specific parameter:
Other general parameters are available.
url

URLs to validate against the block list.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=stashedit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Prepare an edit in shared cache.

This is intended to be used via AJAX from the edit form to improve the performance of the page save.

Specific parameters:
Other general parameters are available.
title

Title of the page being edited.

This parameter is required.
section

Section identifier. 0 for the top section, new for a new section.

sectiontitle

The title for a new section.

text

Page content.

stashedtexthash

Page content hash from a prior stash to use instead.

summary

Change summary.

Default: (empty)
contentmodel

Content model of the new content.

This parameter is required.
One of the following values: GadgetDefinition, JsonSchema, Scribunto, css, javascript, json, sanitized-css, text, unknown, vue, wikibase-item, wikibase-property, wikitext
contentformat

Content serialization format used for the input text.

This parameter is required.
One of the following values: application/json, application/octet-stream, application/unknown, application/vnd.php.serialized, application/vue+xml, application/x-binary, text/css, text/javascript, text/plain, text/unknown, text/x-wiki, unknown/unknown
baserevid

Revision ID of the base revision.

This parameter is required.
Type: integer
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=tag

(main | tag)
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Add or remove change tags from individual revisions or log entries.

Specific parameters:
Other general parameters are available.
rcid

One or more recent changes IDs from which to add or remove the tag.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revid

One or more revision IDs from which to add or remove the tag.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
logid

One or more log entry IDs from which to add or remove the tag.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
add

Tags to add. Only manually defined tags can be added.

Values (separate with | or alternative):
remove

Tags to remove. Only tags that are either manually defined or completely undefined can be removed.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
reason

Reason for the change.

Default: (empty)
tags

Tags to apply to the log entry that will be created as a result of this action.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Examples:
Add the vandalism tag to revision ID 123 without specifying a reason
api.php?action=tag&revid=123&add=vandalism&token=123ABC [open in sandbox]
Remove the spam tag from log entry ID 123 with the reason Wrongly applied
api.php?action=tag&logid=123&remove=spam&reason=Wrongly+applied&token=123ABC [open in sandbox]

action=templatedata

Fetch data stored by the TemplateData extension.

Specific parameters:
Other general parameters are available.
includeMissingTitles

Return data about titles even if they are missing or lack TemplateData. By default titles are only returned if they exist and have TemplateData.

Type: boolean (details)
doNotIgnoreMissingTitles
Deprecated.

Return data about titles even if they are missing or lack TemplateData. By default (for backwards compatibility) titles are only returned if they exist and have TemplateData.

Type: boolean (details)
lang

Return localized values in this language. By default all available translations are returned.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsearch
Internal. Searches for entities using labels and aliases.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
Examples:
Return TemplateData for Template:Foobar, with results if the template does not exist or exists but has no TemplateData
api.php?action=templatedata&titles=Template:Foobar&includeMissingTitles=1 [open in sandbox]
Return TemplateData for Template:Phabricator, with no results if the template does not exist or exists but has no TemplateData
api.php?action=templatedata&titles=Template:Phabricator [open in sandbox]

action=thank

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: Thanks
  • License: MIT

Send a thank-you notification to an editor.

Specific parameters:
Other general parameters are available.
rev

Revision ID to thank someone for. This or 'log' must be provided.

Type: integer
The value must be no less than 1.
log

Log ID to thank someone for. This or 'rev' must be provided.

Type: integer
The value must be no less than 1.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
source

A short string describing the source of the request, for example diff or history.

Example:
Send thanks for revision ID 456, with the source being a diff page
api.php?action=thank&revid=456&source=diff&token=123ABC [open in sandbox]

action=titleblacklist (tb)

  • This module requires read rights.
  • Source: TitleBlacklist
  • License: GPL-2.0-or-later

Validate a page title, filename, or username against the TitleBlacklist.

Specific parameters:
Other general parameters are available.
tbtitle

The string to validate against the blacklist.

This parameter is required.
tbaction

The action to be checked.

One of the following values: create, createpage, createtalk, edit, move, new-account, upload
Default: edit
tbnooverride

Don't try to override the titleblacklist.

Type: boolean (details)

action=unblock

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Unblock a user.

Specific parameters:
Other general parameters are available.
id

ID of the block to unblock (obtained through list=blocks). Cannot be used together with user.

Type: integer
user

User to unblock. Cannot be used together with id.

Type: user, by any of username, IP, Temporary user, IP range and user ID (e.g. "#12345")
userid
Deprecated.

Specify user=#ID instead.

Type: integer
reason

Reason for unblock.

Default: (empty)
tags

Change tags to apply to the entry in the block log.

Values (separate with | or alternative):
watchuser

Watch the user's or IP address's user and talk pages.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=undelete

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Undelete revisions of a deleted page.

A list of deleted revisions (including timestamps) can be retrieved through prop=deletedrevisions, and a list of deleted file IDs can be retrieved through list=filearchive.

Specific parameters:
Other general parameters are available.
title

Title of the page to undelete.

This parameter is required.
reason

Reason for restoring.

Default: (empty)
tags

Change tags to apply to the entry in the deletion log.

Values (separate with | or alternative):
timestamps

Timestamps of the revisions to undelete. If both timestamps and fileids are empty, all will be undeleted.

Type: list of timestamps (allowed formats)
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
fileids

IDs of the file revisions to restore. If both timestamps and fileids are empty, all will be restored.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
undeletetalk

Undelete all revisions of the associated talk page, if any.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, unwatch, watch
Default: preferences
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=unlinkaccount

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Remove a linked third-party account from the current user.

Specific parameters:
Other general parameters are available.
request

Use this authentication request, by the id returned from action=query&meta=authmanagerinfo with amirequestsfor=unlink.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
Example:
Attempt to remove the current user's link for the provider associated with FooAuthenticationRequest.
api.php?action=unlinkaccount&request=FooAuthenticationRequest&token=123ABC [open in sandbox]

action=upload

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Upload a file, or get the status of pending uploads.

Several methods are available:

  • Upload file contents directly, using the file parameter.
  • Upload the file in pieces, using the filesize, chunk, and offset parameters.
  • Have the MediaWiki server fetch a file from a URL, using the url parameter.
  • Complete an earlier upload that failed due to warnings, was uploaded in pieces, or stored otherwise in the upload stash, using the filekey parameter.

Note that the HTTP POST must be done as a file upload (i.e. using multipart/form-data) when sending the file or chunk.

Specific parameters:
Other general parameters are available.
filename

Target filename.

comment

Upload comment. Also used as the initial page text for new files if text is not specified.

Default: (empty)
tags

Change tags to apply to the upload log entry and file page revision.

Values (separate with | or alternative):
text

Initial page text for new files.

watch
Deprecated.

Watch the page.

Type: boolean (details)
watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

One of the following values: nochange, preferences, watch
Default: preferences
ignorewarnings

Ignore any warnings.

Type: boolean (details)
file

File contents.

Must be posted as a file upload using multipart/form-data.
url

URL to fetch the file from.

filekey

Key that identifies a previous upload that was stashed temporarily.

sessionkey
Deprecated.

Same as filekey, maintained for backward compatibility.

stash

If set, the server will stash the file temporarily instead of adding it to the repository.

Type: boolean (details)
filesize

Filesize of entire upload.

Type: integer
The value must be between 0 and 104,857,600.
offset

Offset of chunk in bytes.

Type: integer
The value must be no less than 0.
chunk

Chunk contents.

Must be posted as a file upload using multipart/form-data.
async

Make potentially large file operations asynchronous when possible.

Type: boolean (details)
checkstatus

Only fetch the upload status for the given file key.

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.

action=userrights

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Change a user's group membership.

Specific parameters:
Other general parameters are available.
user

User.

Type: user, by any of username and user ID (e.g. "#12345")
userid
Deprecated.

Specify user=#ID instead.

Type: integer
add

Add the user to these groups, or if they are already a member, update the expiry of their membership in that group.

Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
expiry

Expiry timestamps. May be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). If only one timestamp is set, it will be used for all groups passed to the add parameter. Use infinite, indefinite, infinity, or never for a never-expiring user group.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Default: infinite
remove

Remove the user from these groups.

Values (separate with | or alternative): bot, bureaucrat, checkuser, interface-admin, no-ipinfo, push-subscription-manager, suppress, sysop, temp, temporary-account-viewer
reason

Reason for the change.

Default: (empty)
token

A "userrights" token retrieved from action=query&meta=tokens

For compatibility, the token used in the web UI is also accepted.

This parameter is required.
tags

Change tags to apply to the entry in the user rights log.

Values (separate with | or alternative):
watchuser

Watch the user's user and talk pages.

Type: boolean (details)
Examples:
Add user FooBot to group bot, and remove from groups sysop and bureaucrat.
api.php?action=userrights&user=FooBot&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
Add the user with ID 123 to group bot, and remove from groups sysop and bureaucrat.
api.php?action=userrights&userid=123&add=bot&remove=sysop|bureaucrat&token=123ABC [open in sandbox]
Add user SometimeSysop to group sysop for 1 month.
api.php?action=userrights&user=SometimeSysop&add=sysop&expiry=1%20month&token=123ABC [open in sandbox]

action=validatepassword

  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Validate a password against the wiki's password policies.

Validity is reported as Good if the password is acceptable, Change if the password may be used for login but must be changed, or Invalid if the password is not usable.

Specific parameters:
Other general parameters are available.
password

Password to validate.

This parameter is required.
user

Username, for use when testing account creation. The named user must not exist.

Type: user, by any of username and user ID (e.g. "#12345")
email

Email address, for use when testing account creation.

realname

Real name, for use when testing account creation.

Examples:
Validate the password foobar for the current user.
api.php?action=validatepassword&password=foobar [open in sandbox]
Validate the password qwerty for creating user Example.
api.php?action=validatepassword&password=querty&user=Example [open in sandbox]

action=visualeditor

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: VisualEditor
  • License: MIT

Returns HTML5 for a page from the Parsoid service.

Specific parameters:
Other general parameters are available.
page

The page to perform actions on.

This parameter is required.
badetag

If RESTBase query returned a seemingly invalid ETag, pass it here for logging purposes.

format

The format of the output.

One of the following values: json, jsonfm
Default: jsonfm
paction

Action to perform.

This parameter is required.
One of the following values: metadata, parse, parsefragment, templatesused, wikitext
wikitext

Wikitext to send to Parsoid to convert to HTML (paction=parsefragment).

section

The section on which to act.

stash

When saving, set this true if you want to use the stashing API.

Type: boolean (details)
oldid

The revision number to use (defaults to latest revision).

Type: integer
editintro

Edit intro to add to notices.

pst

Pre-save transform wikitext before sending it to Parsoid (paction=parsefragment).

Type: boolean (details)
preload

The page to use content from if the fetched page has no content yet.

preloadparams

Parameters to substitute into the preload page, if present.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).

action=visualeditoredit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: VisualEditor
  • License: MIT

Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).

Specific parameters:
Other general parameters are available.
paction

Action to perform.

This parameter is required.
One of the following values: diff, save, serialize, serializeforcache
page

The page to perform actions on.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
wikitext

The wikitext to act with.

section

The section on which to act.

sectiontitle

Title for new section.

basetimestamp

When saving, set this to the timestamp of the revision that was edited. Used to detect edit conflicts.

Type: timestamp (allowed formats)
starttimestamp

When saving, set this to the timestamp of when the page was loaded. Used to detect edit conflicts.

Type: timestamp (allowed formats)
oldid

The revision number to use. Defaults to latest revision.

Type: integer
minor

Flag for minor edit.

watchlist

Unconditionally add or remove the page from the current user's watchlist, use preferences (ignored for bot users) or do not change watch.

html

HTML to send to Parsoid in exchange for wikitext.

etag

ETag to send.

summary

Edit summary.

captchaid

Captcha ID (when saving with a captcha response).

captchaword

Answer to the captcha (when saving with a captcha response).

cachekey

Use the result of a previous serializeforcache request with this key. Overrides html.

nocontent

Omit the HTML content of the new revision in the response.

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
useskin

Apply the selected skin to the parser output. May affect the following properties: text, langlinks, headitems, modules, jsconfigvars, indicators.

One of the following values: apioutput, authentication-popup, fallback, json, minerva, monobook, timeless, vector, vector-2022
tags

Change tags to apply to the edit.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
plugins

Plugins associated with the API request.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
data-{plugin}

Arbitrary data sent by a plugin with the API request.

This is a templated parameter. When making the request, {plugin} in the parameter's name should be replaced with values of plugins.

action=watch

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: MediaWiki
  • License: GPL-2.0-or-later

Add or remove pages from the current user's watchlist.

Specific parameters:
Other general parameters are available.
title
Deprecated.

The page to (un)watch. Use titles instead.

labels

Label IDs to assign to the pages being watched. This will replace all existing labels on the pages with the ones specified.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
unwatch

If set the page will be unwatched rather than watched.

Type: boolean (details)
continue

When more results are available, use this to continue. More detailed information on how to continue queries can be found on mediawiki.org.

titles

A list of titles to work on.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
pageids

A list of page IDs to work on.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
revids

A list of revision IDs to work on. Note that almost all query modules will convert revision IDs to the corresponding page ID and work on the latest revision instead. Only prop=revisions uses exact revisions for its response.

Type: list of integers
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generator

Get the list of pages to work on by executing the specified query module.

Note: Generator parameter names must be prefixed with a "g", see examples.

allcategories
Enumerate all categories.
alldeletedrevisions
List all deleted revisions by a user or in a namespace.
allfileusages
List all file usages, including non-existing.
allimages
Enumerate all images sequentially.
alllinks
Enumerate all links that point to a given namespace.
allpages
Enumerate all pages sequentially in a given namespace.
allredirects
List all redirects to a namespace.
allrevisions
List all revisions.
alltransclusions
List all transclusions (pages embedded using {{x}}), including non-existing.
backlinks
Find all pages that link to the given page.
categories
List all categories the pages belong to.
categorymembers
List all pages in a given category.
deletedrevisions
Get deleted revision information.
duplicatefiles
List all files that are duplicates of the given files based on hash values.
embeddedin
Find all pages that embed (transclude) the given title.
exturlusage
Enumerate pages that contain a given URL.
fileusage
Find all pages that use the given files.
images
Returns all files contained on the given pages.
imageusage
Find all pages that use the given image title.
iwbacklinks
Find all pages that link to the given interwiki link.
langbacklinks
Find all pages that link to the given language link.
links
Returns all links from the given pages.
linkshere
Find all pages that link to the given pages.
pageswithprop
List all pages using a given page property.
prefixsearch
Perform a prefix search for page titles.
protectedtitles
List all titles protected from creation.
querypage
Get a list provided by a QueryPage-based special page.
random
Get a set of random pages.
recentchanges
Enumerate recent changes.
redirects
Returns all redirects to the given pages.
revisions
Get revision information.
search
Perform a full text search.
templates
Returns all pages transcluded on the given pages.
trackingcategories
Enumerate all existing tracking categories defined in Special:TrackingCategories. A tracking category exists if it contains pages or if its category page exists.
transcludedin
Find all pages that transclude the given pages.
watchlist
Get recent changes to pages in the current user's watchlist.
watchlistraw
Get all pages on the current user's watchlist.
wblistentityusage
Returns all pages that use the given entity IDs.
wbsearch
Internal. Searches for entities using labels and aliases.
One of the following values: allcategories, alldeletedrevisions, allfileusages, allimages, alllinks, allpages, allredirects, allrevisions, alltransclusions, backlinks, categories, categorymembers, deletedrevisions, duplicatefiles, embeddedin, exturlusage, fileusage, images, imageusage, iwbacklinks, langbacklinks, links, linkshere, pageswithprop, prefixsearch, protectedtitles, querypage, random, recentchanges, redirects, revisions, search, templates, trackingcategories, transcludedin, watchlist, watchlistraw, wblistentityusage, wbsearch
redirects

Automatically resolve redirects in titles, pageids, and revids, and in pages returned by generator.

Type: boolean (details)
converttitles

Convert titles to other variants if necessary. Only works if the wiki's content language supports variant conversion. Languages that support variant conversion include ban, crh, en, gan, iu, ku, mni, sh, shi, sr, tg, tly, uz, wuu, zgh and zh.

Type: boolean (details)
token

A "watch" token retrieved from action=query&meta=tokens

This parameter is required.

action=wbavailablebadges

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Queries available badge items.

Example:
Queries all available badge items
api.php?action=wbavailablebadges [open in sandbox]

action=wbcreateclaim

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Creates Wikibase claims.

Specific parameters:
Other general parameters are available.
entity

ID of the entity the claim is being added to

This parameter is required.
snaktype

The type of the snak

This parameter is required.
One of the following values: novalue, somevalue, value
property

ID of the snaks property

This parameter is required.
value

Value of the snak when creating a claim with a snak that has a value

summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)

action=wbcreateredirect

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Creates Entity redirects.

Specific parameters:
Other general parameters are available.
from

Entity ID to make a redirect

This parameter is required.
to

Entity ID to point the redirect to

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
Example:
Turn Q999999998 into a redirect to Q999999999
api.php?action=wbcreateredirect&from=Q999999998&to=Q999999999 [open in sandbox]

action=wbeditentity

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Creates a single new Wikibase entity and modifies it with serialised information.

Specific parameters:
Other general parameters are available.
id

The identifier for the entity, including the prefix. Use either id or site and title together.

new

If set, a new entity will be created. Set this to the type of the entity to be created. It is not allowed to have this set when id is also set.

One of the following values: item, property
site

An identifier for the site on which the page resides. Use together with title to make a complete sitelink.

One of the following values:
title

Title of the page to associate. Use together with site to make a complete sitelink.

baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
data

The serialized object that is used as the data source. A newly created entity will be assigned an 'id'.

This parameter is required.
clear

If set, the complete entity is emptied before proceeding. The entity will not be saved before it is filled with the "data", possibly with parts excluded.

Type: boolean (details)
Examples:
Create a new empty item, return full entity structure
api.php?action=wbeditentity&new=item&data={} [open in sandbox]
Create a new item and set labels for de and en
api.php?action=wbeditentity&new=item&data={"labels":{"de":{"language":"de","value":"de-value"},"en":{"language":"en","value":"en-value"}}} [open in sandbox]
Create a new property containing the json data, return full entity structure
api.php?action=wbeditentity&new=property&data={"labels":{"en-gb":{"language":"en-gb","value":"Propertylabel"}},"descriptions":{"en-gb":{"language":"en-gb","value":"Propertydescription"}},"datatype":"string"} [open in sandbox]
Clear all data from entity with ID Q999999998
api.php?action=wbeditentity&clear=true&id=Q999999998&data={} [open in sandbox]
Clear all data from entity with ID Q999999998 and set a label for en
api.php?action=wbeditentity&clear=true&id=Q999999998&data={"labels":{"en":{"language":"en","value":"en-value"}}} [open in sandbox]
Adds a label without overwriting it if it already exists
api.php?action=wbeditentity&id=Q999999998&data={"labels":[{"language":"no","value":"Bar","add":""}]} [open in sandbox]
Removes a label
api.php?action=wbeditentity&id=Q999999998&data={"labels":[{"language":"en","value":"Foo","remove":""}]} [open in sandbox]
Sets sitelink for nowiki, overwriting it if it already exists
api.php?action=wbeditentity&id=Q999999998&data={"sitelinks":{"nowiki":{"site":"nowiki","title":"København"}}} [open in sandbox]
Sets description for nb, overwriting it if it already exists
api.php?action=wbeditentity&id=Q999999998&data={"descriptions":{"nb":{"language":"nb","value":"nb-Description-Here"}}} [open in sandbox]
Creates a new claim on the item for the property P56 and a value of "ExampleString"
api.php?action=wbeditentity&id=Q999999998&data={"claims":[{"mainsnak":{"snaktype":"value","property":"P56","datavalue":{"value":"ExampleString","type":"string"}},"type":"statement","rank":"normal"}]} [open in sandbox]
Removes the claims from the item with the provided GUIDs
api.php?action=wbeditentity&id=Q999999998&data={"claims":[{"id":"Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F","remove":""},{"id":"Q999999998$GH678DSA-01PQ-28XC-HJ90-DDFD9990126X","remove":""}]} [open in sandbox]
Sets the claim with the GUID to the value of the claim
api.php?action=wbeditentity&id=Q999999998&data={"claims":[{"id":"Q999999998$GH678DSA-01PQ-28XC-HJ90-DDFD9990126X","mainsnak":{"snaktype":"value","property":"P56","datavalue":{"value":"ChangedString","type":"string"}},"type":"statement","rank":"normal"}]} [open in sandbox]

action=wbformatentities

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Formats entity IDs to HTML or plain text.

The language can be specified with the global uselang parameter.

Specific parameters:
Other general parameters are available.
ids

The entity IDs to format.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
generate

The desired output format to generate.

One of the following values: text/html, text/plain
Default: text/html

action=wbformatvalue

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Formats DataValues.

Specific parameters:
Other general parameters are available.
generate

The desired output format to generate.

One of the following values: text/html, text/html; disposition=verbose, text/html; disposition=verbose-preview, text/plain, text/x-wiki
Default: text/x-wiki
datavalue

The data to format. This has to be the JSON serialization of a DataValue object.

This parameter is required.
datatype

The value's data type. This is distinct from the value's type

One of the following values: commonsMedia, external-id, geo-shape, globe-coordinate, monolingualtext, quantity, string, tabular-data, time, url, wikibase-item, wikibase-property
property

Property ID the data value belongs to, should be used instead of the datatype parameter.

options

The options the formatter should use. Provided as a JSON object.

The supported options are:

lang
The language in which the value should be formatted (a MediaWiki language code).
applyRounding
Whether to apply rounding to the number. Can be a boolean (automatic / no rounding) or an integer (exponent of the last significant decimal digits). Only useful for quantity values.
applyUnit
Whether to include the unit in the output (a boolean). Only useful for quantity values.
showcalendar
Whether to show the calendar model. Can be a boolean (always / never show) or the string "auto" (automatically determine whether to show). Only useful for time values.

action=wbgetclaims

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Gets Wikibase claims.

Specific parameters:
Other general parameters are available.
entity

ID of the entity from which to obtain claims. Required unless claim GUID is provided.

property

Optional filter to only return claims with a main snak that has the specified property.

claim

A GUID identifying the claim. Required unless entity is provided. The GUID is the globally unique identifier for a claim, e.g. "q42$D8404CDA-25E4-4334-AF13-A3290BCD9C0F".

rank

Optional filter to return only the claims that have the specified rank

One of the following values: deprecated, normal, preferred
props

Some parts of the claim are returned optionally. This parameter controls which ones are returned.

Values (separate with | or alternative): references
Default: references
Examples:
Get claims for item with ID Q42
api.php?action=wbgetclaims&entity=Q42 [open in sandbox]
Get claims for item with ID Q42 and property with ID P31
api.php?action=wbgetclaims&entity=Q42&property=P31 [open in sandbox]
Get claims for item with ID Q42 that are ranked as normal
api.php?action=wbgetclaims&entity=Q42&rank=normal [open in sandbox]
Get claim with GUID of Q42$D8404CDA-25E4-4334-AF13-A3290BCD9C0F
api.php?action=wbgetclaims&claim=Q42$D8404CDA-25E4-4334-AF13-A3290BCD9C0F [open in sandbox]

action=wbgetentities

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Gets the data for multiple Wikibase entities.

Specific parameters:
Other general parameters are available.
ids

The IDs of the entities to get the data from

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
sites

Identifier for the site on which the corresponding page resides. Use together with title, but only give one site for several titles or several sites for one title.

Values (separate with | or alternative):
Maximum number of values is 50 (500 for clients that are allowed higher limits).
titles

The title of the corresponding page. Use together with sites, but only give one site for several titles or several sites for one title.

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
redirects

Whether redirects shall be resolved. If set to "no", redirects will be treated like deleted entities.

One of the following values: no, yes
Default: yes
props

The names of the properties to get back from each entity. Will be further filtered by any languages given.

Values (separate with | or alternative): aliases, claims, datatype, descriptions, info, labels, sitelinks, sitelinks/urls
Default: info|sitelinks|aliases|labels|descriptions|claims|datatype
languages

By default the internationalized values are returned in all available languages. This parameter allows filtering these down to one or more languages by providing one or more language codes.

Values (separate with | or alternative): aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
Maximum number of values is 50 (500 for clients that are allowed higher limits).
languagefallback

Apply language fallback for languages defined in the languages parameter, with the current context of API call.

Type: boolean (details)
normalize

Try to normalize the page title against the client site. This only works if exactly one site and one page have been given.

Type: boolean (details)
sitefilter

Filter sitelinks in entities to those with these site IDs.

Values (separate with | or alternative):
Maximum number of values is 50 (500 for clients that are allowed higher limits).
Examples:
Get entities with ID Q42 with all available attributes in all available languages
api.php?action=wbgetentities&ids=Q42 [open in sandbox]
Get entities with ID P17 with all available attributes in all available languages
api.php?action=wbgetentities&ids=P17 [open in sandbox]
Get entities with IDs Q42 and P17 with all available attributes in all available languages
api.php?action=wbgetentities&ids=Q42|P17 [open in sandbox]
Get entities with ID Q42 with all available attributes in English language
api.php?action=wbgetentities&ids=Q42&languages=en [open in sandbox]
Get entities with ID Q42 with all available attributes in any possible fallback language for the ii language
api.php?action=wbgetentities&ids=Q42&languages=ii&languagefallback= [open in sandbox]
Get entities with ID Q42 showing all labels in all available languages
api.php?action=wbgetentities&ids=Q42&props=labels [open in sandbox]
Get entities with IDs P17 and P3 showing only datatypes
api.php?action=wbgetentities&ids=P17|P3&props=datatype [open in sandbox]
Get entities with ID Q42 showing all aliases in English language
api.php?action=wbgetentities&ids=Q42&props=aliases&languages=en [open in sandbox]
Get entities with IDs Q1 and Q42 showing descriptions in English, German and French languages
api.php?action=wbgetentities&ids=Q1|Q42&props=descriptions&languages=en|de|fr [open in sandbox]
Get the item for page "Berlin" on the site "enwiki", with language attributes in English language
api.php?action=wbgetentities&sites=enwiki&titles=Berlin&languages=en [open in sandbox]
Get the item for page "Berlin" on the site "enwiki" after normalizing the title from "berlin"
api.php?action=wbgetentities&sites=enwiki&titles=berlin&normalize= [open in sandbox]
Get the sitelinks for item Q42
api.php?action=wbgetentities&ids=Q42&props=sitelinks [open in sandbox]
Get entities with ID Q42 showing only sitelinks from "enwiki"
api.php?action=wbgetentities&ids=Q42&sitefilter=enwiki [open in sandbox]

action=wblinktitles

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Associates two pages on two different wikis with a Wikibase item.

Specific parameters:
Other general parameters are available.
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
tosite

An identifier for the site on which the page resides. Use together with totitle to make a complete sitelink.

This parameter is required.
One of the following values:
totitle

Title of the page to associate. Use together with tosite to make a complete sitelink.

This parameter is required.
fromsite

An identifier for the site on which the page resides. Use together with fromtitle to make a complete sitelink.

This parameter is required.
One of the following values:
fromtitle

Title of the page to associate. Use together with fromsite to make a complete sitelink.

This parameter is required.
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".

Type: boolean (details)
Example:
Add a link "Hydrogen" from the English page to "Wasserstoff" at the German page
api.php?action=wblinktitles&fromsite=enwiki&fromtitle=Hydrogen&tosite=dewiki&totitle=Wasserstoff [open in sandbox]

action=wbmergeitems

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Merges multiple items.

Specific parameters:
Other general parameters are available.
fromid

The ID to merge from

This parameter is required.
toid

The ID to merge to

This parameter is required.
ignoreconflicts

Array of elements of the item to ignore conflicts for. Can only contain values of "description", "sitelink" and "statement"

Values (separate with | or alternative): description, sitelink, statement
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revisions.

Values (separate with | or alternative):
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".

Type: boolean (details)
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
Examples:
Merges data from Q999999998 into Q999999999
api.php?action=wbmergeitems&fromid=Q999999998&toid=Q999999999 [open in sandbox]
Merges data from Q999999998 into Q999999999 ignoring any conflicting sitelinks
api.php?action=wbmergeitems&fromid=Q999999998&toid=Q999999999&ignoreconflicts=sitelink [open in sandbox]
Merges data from Q999999998 into Q999999999 ignoring any conflicting sitelinks and descriptions
api.php?action=wbmergeitems&fromid=Q999999998&toid=Q999999999&ignoreconflicts=sitelink|description [open in sandbox]

action=wbparsevalue

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Parses values using a ValueParser.

Specific parameters:
Other general parameters are available.
datatype

Datatype of the value to parse. Determines the parser to use.

One of the following values: commonsMedia, external-id, geo-shape, globe-coordinate, monolingualtext, quantity, string, tabular-data, time, url, wikibase-item, wikibase-property
property

Property ID the value to parse belongs to. Determines the parser to use.

parser
Deprecated.

ID of the ValueParser to use. Deprecated. Use the datatype parameter instead.

One of the following values: commonsMedia, external-id, geo-shape, globe-coordinate, globecoordinate, monolingualtext, null, quantity, string, tabular-data, time, url, wikibase-entityid, wikibase-item, wikibase-property
values

The values to parse

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
options

The options the parser should use. Provided as a JSON object.

validate

Whether to additionally verify the data passed in.

Type: boolean (details)
Examples:
Parse a plain string into a StringValue object.
api.php?action=wbparsevalue&datatype=string&values=foo|bar [open in sandbox]
Parse 1994-02-08 to a TimeValue object with a precision of 9 (year).
api.php?action=wbparsevalue&datatype=time&values=1994-02-08&options={"precision":9} [open in sandbox]
Parse 1994-02-08 to a TimeValue object with a precision of 14 (second) with validation enabled, resulting in a validation failure.
api.php?action=wbparsevalue&datatype=time&validate&values=1994-02-08&options={"precision":14} [open in sandbox]
Parse foo into an object of whatever datatype P123 is, with validation enabled, potentially resulting in a validation failure depending on P123's datatype's expected input.
api.php?action=wbparsevalue&property=P123&validate&values=foo [open in sandbox]

action=wbremoveclaims

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Removes Wikibase claims.

Specific parameters:
Other general parameters are available.
claim

One GUID or several (pipe-separated) GUIDs identifying the claims to be removed. All claims must belong to the same entity.

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)

action=wbremovequalifiers

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Removes a qualifier from a claim.

Specific parameters:
Other general parameters are available.
claim

A GUID identifying the claim from which to remove qualifiers

This parameter is required.
qualifiers

Snak hashes of the qualifiers to remove

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
Example:
Remove qualifier with hash "1eb8793c002b1d9820c833d234a1b54c8e94187e" from claim with GUID of "Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F"
api.php?action=wbremovequalifiers&claim=Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F&qualifiers=1eb8793c002b1d9820c833d234a1b54c8e94187e&token=foobar&baserevid=7201010 [open in sandbox]

action=wbremovereferences

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Removes one or more references of the same statement.

Specific parameters:
Other general parameters are available.
statement

A GUID identifying the statement for which a reference is being set

This parameter is required.
references

The hashes of the references that should be removed

This parameter is required.
Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
Example:
Remove reference with hash "455481eeac76e6a8af71a6b493c073d54788e7e9" from the statement with GUID of "Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F"
api.php?action=wbremovereferences&statement=Q999999998$D8404CDA-25E4-4334-AF13-A3290BCD9C0F&references=455481eeac76e6a8af71a6b493c073d54788e7e9&token=foobar&baserevid=7201010 [open in sandbox]

action=wbsearchentities

  • This module requires read rights.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Searches for entities using labels and aliases.

Returns a label and description for the entity in the user language if possible. Returns details of the matched term. The matched term text is also present in the aliases key if different from the display label.

Specific parameters:
Other general parameters are available.
search

Search for this text.

This parameter is required.
language

Search in this language. This only affects how entities are selected, not the language in which the results are returned: this is controlled by the "uselang" parameter.

This parameter is required.
One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
strictlanguage

Whether to disable language fallback

Type: boolean (details)
type

Search for this type of entity.

One of the following values: item, item, property, property
Default: item
limit

Maximal number of results

Type: integer or max
The value must be between 0 and 50.
Default: 7
continue

Offset where to continue a search

Type: integer
The value must be between 0 and 10,000.
Default: 0
props

Return these properties for each entity.

Values (separate with | or alternative): url
Default: url
profile

The search profile to use.

default
The default profile, suitable for most purposes.
One of the following values: default
Default: default
Examples:
Search for "abc" in English language, with defaults for type and limit
api.php?action=wbsearchentities&search=abc&language=en [open in sandbox]
Search for "abc" in English language with a limit of 50
api.php?action=wbsearchentities&search=abc&language=en&limit=50 [open in sandbox]
Search for "abc" in English language with a limit of 2 and an offset of 2
api.php?action=wbsearchentities&search=abc&language=en&limit=2&continue=2 [open in sandbox]
Search only properties for "alphabet" in English language
api.php?action=wbsearchentities&search=alphabet&language=en&type=property [open in sandbox]
Search for "alphabet" in English language omitting url parameter
api.php?action=wbsearchentities&search=alphabet&language=en&props= [open in sandbox]
Search for "Q1234" in English language, to match the entity ID.
api.php?action=wbsearchentities&search=Q1234&language=en [open in sandbox]

action=wbsetaliases

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Sets the aliases for a Wikibase entity.

Specific parameters:
Other general parameters are available.
id

The identifier for the entity, including the prefix. Use either id or site and title together.

new

If set, a new entity will be created. Set this to the type of the entity you want to create.

One of the following values: item, property
site

An identifier for the site on which the page resides. Use together with title to make a complete sitelink.

One of the following values:
title

Title of the page to associate. Use together with site to make a complete sitelink.

baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
add

List of aliases to add (can be combined with remove)

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
remove

List of aliases to remove (can be combined with add)

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
set

A list of aliases that will replace the current list (cannot be combined with neither add nor remove)

Separate values with | or alternative.
Maximum number of values is 50 (500 for clients that are allowed higher limits).
language

The language for which to set the aliases

This parameter is required.
One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
Examples:
Set the English aliases for the entity with ID Q999999998 to Foo and Bar
api.php?action=wbsetaliases&language=en&id=Q999999998&set=Foo|Bar [open in sandbox]
Add Foo and Bar to the list of English aliases for the entity with ID Q999999998
api.php?action=wbsetaliases&language=en&id=Q999999998&add=Foo|Bar [open in sandbox]
Remove Foo and Bar from the list of English aliases for the entity with ID Q999999998
api.php?action=wbsetaliases&language=en&id=Q999999998&remove=Foo|Bar [open in sandbox]
Remove Foo from the list of English aliases for the entity with ID Q999999998 while adding Bar to it
api.php?action=wbsetaliases&language=en&id=Q999999998&remove=Foo&add=Bar [open in sandbox]

action=wbsetclaim

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Creates or updates an entire Statement or Claim.

Specific parameters:
Other general parameters are available.
claim

Statement or Claim serialization

This parameter is required.
index

The index within the entity's list of statements to move the statement to. Optional. Be aware that when setting an index that specifies a position not next to a statement whose main snak does not feature the same property, the whole group of statements whose main snaks feature the same property is moved. When not provided, an existing statement will stay in place while a new statement will be appended to the last one whose main snak features the same property.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
ignoreduplicatemainsnak

If this is true, and the entity already has a claim with the same main snak as the claim being sent in the request, then the request is ignored

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
Examples:
Set the claim with the given ID to property P1 with a string value of "City"
api.php?action=wbsetclaim&claim={"id":"Q999999998$5627445f-43cb-ed6d-3adb-760e85bd17ee","type":"claim","mainsnak":{"snaktype":"value","property":"P1","datavalue":{"value":"City","type":"string"}}} [open in sandbox]
Set the claim with the given ID to property P1 with a string value of "City" and move the claim to the topmost position within the entity's subgroup of claims that feature the main snak property P1. In addition, move the whole subgroup to the top of all subgroups aggregated by property.
api.php?action=wbsetclaim&claim={"id":"Q999999998$5627445f-43cb-ed6d-3adb-760e85bd17ee","type":"claim","mainsnak":{"snaktype":"value","property":"P1","datavalue":{"value":"City","type":"string"}}}&index=0 [open in sandbox]
Set the Statement with the given ID to Property P1 with a string value of "City" and set the Statement's References to a single Reference featuring the string value "The Economy of Cities" assigned to the Property P2.
api.php?action=wbsetclaim&claim={"id":"Q999999998$5627445f-43cb-ed6d-3adb-760e85bd17ee","type":"statement","mainsnak":{"snaktype":"value","property":"P1","datavalue":{"value":"City","type":"string"}},"references":[{"snaks":{"P2":[{"snaktype":"value","property":"P2","datavalue":{"value":"The Economy of Cities","type":"string"}}]},"snaks-order":["P2"]}],"rank":"normal"} [open in sandbox]

action=wbsetclaimvalue

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Sets the value of a Wikibase claim.

Specific parameters:
Other general parameters are available.
claim

A GUID identifying the claim

This parameter is required.
value

The value to set the DataValue of the main snak of the claim to

snaktype

The type of the snak

This parameter is required.
One of the following values: novalue, somevalue, value
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)

action=wbsetdescription

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Sets a description for a single Wikibase entity.

Specific parameters:
Other general parameters are available.
id

The identifier for the entity, including the prefix. Use either id or site and title together.

new

If set, a new entity will be created. Set this to the type of the entity you want to create.

One of the following values: item, property
site

An identifier for the site on which the page resides. Use together with title to make a complete sitelink.

One of the following values:
title

Title of the page to associate. Use together with site to make a complete sitelink.

baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
language

Language of the description

This parameter is required.
One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
value

The value to set for the description

Examples:
Set the string "An encyclopedia that everyone can edit" for page with ID "Q999999998" as a description in English language
api.php?action=wbsetdescription&id=Q999999998&language=en&value=An%20encyclopedia%20that%20everyone%20can%20edit [open in sandbox]
Set the string "An encyclopedia that everyone can edit" as a description in English language for page with a sitelink to enwiki:Wikipedia
api.php?action=wbsetdescription&site=enwiki&title=Wikipedia&language=en&value=An%20encyclopedia%20that%20everyone%20can%20edit [open in sandbox]

action=wbsetlabel

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Sets a label for a single Wikibase entity.

Specific parameters:
Other general parameters are available.
id

The identifier for the entity, including the prefix. Use either id or site and title together.

new

If set, a new entity will be created. Set this to the type of the entity you want to create.

One of the following values: item, property
site

An identifier for the site on which the page resides. Use together with title to make a complete sitelink.

One of the following values:
title

Title of the page to associate. Use together with site to make a complete sitelink.

baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
language

Language of the label

This parameter is required.
One of the following values: aa, aae, ab, abr, abs, ace, acf, acm, ady, ady-cyrl, aeb, aeb-arab, aeb-latn, af, agq, aig, aln, als, alt, am, ami, an, ang, ann, anp, apc, ar, arc, arn, arq, ary, arz, as, ase, ast, atj, av, avk, awa, ay, az, azb, ba, bag, ban, ban-bali, bar, bas, bat-smg, bax, bbc, bbc-latn, bbj, bcc, bci, bcl, bdr, be, be-tarask, be-x-old, bew, bfd, bfw, bg, bgc, bgn, bh, bho, bi, bjn, bkc, bkh, bkm, blk, bm, bn, bo, bol, bpy, bqi, bqz, br, brh, bs, btm, bto, bug, bug-bugi, bxr, byv, ca, cak, cal, cbk-zam, ccp, cdo, cdo-hant, cdo-latn, ce, ceb, ch, chn, cho, chr, chy, ckb, cnh, co, cop, cps, cpx, cpx-hans, cpx-hant, cpx-latn, cr, crh, crh-cyrl, crh-latn, crh-ro, cs, csb, cu, cv, cy, da, dag, de, de-at, de-ch, de-formal, dga, din, diq, dlg, dsb, dso, dtp, dty, dua, dv, dz, ee, efi, egl, el, eml, en, en-ca, en-gb, en-us, eo, es, es-419, es-formal, et, eto, etu, eu, ewo, ext, fa, fat, ff, fi, fit, fiu-vro, fj, fkv, fmp, fo, fon, fr, frc, frp, frr, frs, fur, fvr, fy, ga, gaa, gag, gan, gan-hans, gan-hant, gcf, gcr, gd, gju-arab, gju-deva, gl, gld, glk, gn, gom, gom-deva, gom-latn, gor, got, gpe, grc, gsw, gu, guc, gur, guw, gv, gya, ha, hak, hak-hans, hak-hant, hak-latn, haw, he, hi, hif, hif-latn, hil, hke, hno, ho, hoc, hoc-latn, hr, hrx, hsb, hsn, ht, hu, hu-formal, hy, hyw, hz, ia, iba, ibb, id, ie, ig, igl, ii, ik, ike-cans, ike-latn, ilo, inh, io, is, isu, isv, isv-cyrl, isv-latn, it, iu, ja, jam, jbo, jut, jv, jv-java, ka, kaa, kab, kai, kaj, kbd, kbd-cyrl, kbp, kcg, kea, ker, kg, kge, kgg, khw, ki, kiu, kj, kjh, kjp, kk, kk-arab, kk-cn, kk-cyrl, kk-kz, kk-latn, kk-tr, kl, km, kn, knc, ko, ko-kp, koi, kr, krc, kri, krj, krl, ks, ks-arab, ks-deva, ksf, ksh, ksw, ku, ku-arab, ku-latn, kum, kus, kv, kw, ky, la, lad, lb, lbe, lem, lez, lfn, lg, li, lij, liv, ljp, lki, lkt, lld, lmo, ln, lns, lo, loz, lrc, lt, ltg, lua, lus, luz, lv, lzh, lzz, mad, mag, mai, map-bms, mcn, mcp, mdf, mg, mh, mhr, mi, min, mk, ml, mn, mnc, mnc-latn, mnc-mong, mni, mnw, mo, mos, mr, mrh, mrj, ms, ms-arab, mt, mua, mui, mus, mwl, my, myv, mzn, na, nah, nan, nan-hani, nan-hant, nan-latn-pehoeji, nan-latn-tailo, nap, nb, nds, nds-nl, ne, new, ng, nge, nia, nit, niu, nl, nl-informal, nla, nmg, nmz, nn, nnh, nnz, no, nod, nog, nov, nqo, nr, nrm, nso, nup, nv, ny, nyn, nyo, nys, oc, ojb, olo, om, or, os, osa-latn, ota, pa, pag, pam, pap, pap-aw, pcd, pcm, pdc, pdt, pfl, pi, pih, pl, pms, pnb, pnt, ppl, prg, ps, pt, pt-br, pwn, qu, quc, qug, rgn, rif, rki, rm, rmc, rmf, rmy, rn, ro, roa-rup, roa-tara, rsk, ru, rue, rup, ruq, ruq-cyrl, ruq-latn, rut, rw, rwr, ryu, sa, sah, sas, sat, sc, scn, sco, sd, sdc, sdh, se, se-fi, se-no, se-se, sei, ses, sg, sgs, sh, sh-cyrl, sh-latn, shi, shi-latn, shi-tfng, shn, shy, shy-latn, si, simple, sjd, sje, sju, sk, skr, skr-arab, sl, sli, sm, sma, smj, smn, sms, sn, so, sq, sr, sr-ec, sr-el, srn, sro, srq, ss, st, stq, sty, su, sv, sva, sw, syl, szl, szy, ta, tay, tcy, tdd, te, tet, tg, tg-cyrl, tg-latn, th, thq, ti, tig, tk, tl, tly, tly-cyrl, tn, to, tok, tpi, tpv, tr, tru, trv, ts, tt, tt-cyrl, tt-latn, ttj, tum, tvu, tw, ty, tyv, tzm, udm, ug, ug-arab, ug-latn, uk, ur, uz, uz-cyrl, uz-latn, ve, vec, vep, vi, vls, vmf, vmw, vo, vot, vro, vut, wa, wal, war, wes, wls, wlx, wo, wuu, wuu-hans, wuu-hant, wya, xal, xh, xmf, xsy, yas, yat, yav, ybb, yi, yo, yrl, yua, yue, yue-hans, yue-hant, za, zea, zgh, zgh-latn, zh, zh-classical, zh-cn, zh-hans, zh-hant, zh-hk, zh-min-nan, zh-mo, zh-my, zh-sg, zh-tw, zh-yue, zu
value

The value of the label

Examples:
Set the string "Wikimedia" for page with ID "Q999999998" as a label in English language and report it as pretty printed JSON.
api.php?action=wbsetlabel&id=Q999999998&language=en&value=Wikimedia&format=jsonfm [open in sandbox]
Set the English language label to "Earth" for the item with sitelink enwiki => "Earth".
api.php?action=wbsetlabel&site=enwiki&title=Earth&language=en&value=Earth [open in sandbox]

action=wbsetqualifier

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Creates a qualifier or sets the value of an existing one.

Specific parameters:
Other general parameters are available.
claim

A GUID identifying the claim for which a qualifier is being set

This parameter is required.
property

ID of the snaks property. Should only be provided when creating a new qualifier or changing the property of an existing one

value

The new value of the qualifier. Should only be provided for PropertyValueSnak qualifiers

snaktype

The type of the snak. Should only be provided when creating a new qualifier or changing the type of an existing one

One of the following values: novalue, somevalue, value
snakhash

The hash of the snak to modify. Should only be provided for existing qualifiers

summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "Bots".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)

action=wbsetreference

  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Creates a reference or sets the value of an existing one.

Specific parameters:
Other general parameters are available.
statement

A GUID identifying the statement for which a reference is being set

This parameter is required.
snaks

The snaks to set the reference to. JSON object with property IDs pointing to arrays containing the snaks for that property

This parameter is required.
snaks-order

The order of the snaks. JSON array of property ID strings

reference

A hash of the reference that should be updated. Optional. When not provided, a new reference is created

index

The index within the statement's list of references where to move the reference to. Optional. When not provided, an existing reference will stay in place while a new reference will be appended.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
  • This module requires read rights.
  • This module requires write rights.
  • This module only accepts POST requests.
  • Source: WikibaseClient
  • License: GPL-2.0-or-later

Associates a page on a wiki with a Wikibase item or removes an already made such association.

Specific parameters:
Other general parameters are available.
id

The identifier for the entity, including the prefix. Use either id or site and title together.

new

If set, a new entity will be created. Set this to the type of the entity you want to create.

One of the following values: item, property
site

An identifier for the site on which the page resides. Use together with title to make a complete sitelink.

One of the following values:
title

Title of the page to associate. Use together with site to make a complete sitelink.

baserevid

The numeric identifier for the revision to base the modification on. This is used for detecting conflicts during save.

Type: integer
summary

Summary for the edit. Will be prepended by an automatically generated comment. The length limit of the autocomment together with the summary is 260 characters. Be aware that everything above that limit will be cut off.

tags

Change tags to apply to the revision.

Values (separate with | or alternative):
token

A "csrf" token retrieved from action=query&meta=tokens

This parameter is required.
bot

Mark this edit as bot. This URL flag will only be respected if the user belongs to the group "bot".

Type: boolean (details)
returnto

Page title. If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to the given page, instead of the page that was edited.

Type: page title
Accepts non-existent pages.
returntoquery

URL query parameters (with leading ?). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given query parameters.

Default: (empty)
returntoanchor

URL fragment (with leading #). If saving the edit created a temporary account, the API may respond with an URL that the client should visit to complete logging in. If this parameter is provided, the URL will redirect to a page with the given fragment.

Default: (empty)
linksite

The identifier of the site on which the page to link resides

This parameter is required.
One of the following values:
linktitle

The title of the page to link. If this parameter is an empty string or both linktitle and badges are not set, the link will be removed.

badges

The IDs of items to be set as badges. They will replace the current ones. If this parameter is not set, the badges will not be changed

Values (separate with | or alternative):
Examples:
Add a sitelink to the English page "Hydrogen" to the item with ID Q999999998, if the sitelink does not exist
api.php?action=wbsetsitelink&id=Q999999998&linksite=enwiki&linktitle=Hydrogen [open in sandbox]
Add a sitelink to the English page "Hydrogen" to the item with ID Q999999998, if the sitelink does not exist. Also appends "Loves Oxygen" to the edit summary.
api.php?action=wbsetsitelink&id=Q999999998&linksite=enwiki&linktitle=Hydrogen&summary=Loves%20Oxygen [open in sandbox]
Add a sitelink to the German page "Wasserstoff" to the item that is linked with the English page "Hydrogen", if the sitelink does not exist
api.php?action=wbsetsitelink&site=enwiki&title=Hydrogen&linksite=dewiki&linktitle=Wasserstoff [open in sandbox]
Remove the German sitelink from the item
api.php?action=wbsetsitelink&site=enwiki&title=Hydrogen&linksite=dewiki [open in sandbox]
Add a sitelink to the Polish page "Wodór" to the item that is linked with the English page "Hydrogen", with one badge pointing to the item with ID "Q149"
api.php?action=wbsetsitelink&site=enwiki&title=Hydrogen&linksite=plwiki&linktitle=Wodór&badges=Q149 [open in sandbox]
Change badges for the link to the Polish page from the item with ID Q999999998 to two badges pointing to the items with IDs "Q2" and "Q149" without providing the link title
api.php?action=wbsetsitelink&id=Q999999998&linksite=plwiki&badges=Q2|Q149 [open in sandbox]
Change the link to the Polish page from the item with ID Q999999998 without changing badges
api.php?action=wbsetsitelink&id=Q999999998&linksite=plwiki&linktitle=Warszawa [open in sandbox]
Change the link to the Polish page from the item with ID Q999999998 and remove all of its badges
api.php?action=wbsetsitelink&id=Q999999998&linksite=plwiki&linktitle=Wodór&badges= [open in sandbox]

action=webauthn

API Module to communicate between server and client during registration/authentication process.

Specific parameters:
Other general parameters are available.
func

Name of the requested function to be executed.

getAuthInfo
Authentication information.
getRegisterInfo
Registration information.
register
Register a new WebAuthn credential for the current user.
This parameter is required.
One of the following values: getAuthInfo, getRegisterInfo, register
passkeyMode

Whether the key being registered is in passkey mode. (Only for getRegisterInfo.)

Type: boolean (details)
credential

JSON-encoded WebAuthn credential response from the browser.

friendlyname

Friendly name for the new credential.

action=wikimediaeventsblockededit

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • Source: WikimediaEvents
  • License: GPL-2.0-or-later

Log information about blocked edit attempts

Specific parameters:
Other general parameters are available.
page

A page on which an edit attempt was made

This parameter is required.
interface

The interface which was used to edit

This parameter is required.
One of the following values: discussiontools, mobilefrontend, other, visualeditor, wikieditor
platform

The platform which was used to edit

This parameter is required.
One of the following values: desktop, mobile

action=wikimediaeventshcaptchaeditattempt

  • This module is internal or unstable, and you should not use it. Its operation may change without notice.
  • This module requires read rights.
  • This module only accepts POST requests.
  • Source: WikimediaEvents
  • License: GPL-2.0-or-later

Log edit diff when hCaptcha challenge is shown but edit is incomplete

Specific parameters:
Other general parameters are available.
title

Page title

This parameter is required.
proposed_content

Proposed content text (max 8KB)

This parameter is required.
editing_session_id

Editing session ID

This parameter is required.
revision_id

Revision ID of the page being edited

This parameter is required.
Type: integer

format=json

Output data in JSON format.

Specific parameters:
Other general parameters are available.
callback

If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.

utf8

If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.

Type: boolean (details)
ascii

If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.

Type: boolean (details)
formatversion

Output formatting

1
Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
2
Modern format.
latest
Use the latest format (currently 2), may change without warning.
One of the following values: 1, 2, latest
Default: 1

format=jsonfm

Output data in JSON format (pretty-print in HTML).

Specific parameters:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)
callback

If specified, wraps the output into a given function call. For safety, all user-specific data will be restricted.

utf8

If specified, encodes most (but not all) non-ASCII characters as UTF-8 instead of replacing them with hexadecimal escape sequences. Default when formatversion is not 1.

Type: boolean (details)
ascii

If specified, encodes all non-ASCII using hexadecimal escape sequences. Default when formatversion is 1.

Type: boolean (details)
formatversion

Output formatting

1
Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
2
Modern format.
latest
Use the latest format (currently 2), may change without warning.
One of the following values: 1, 2, latest
Default: 1

format=none

Output nothing.

format=php

(main | php)

Output data in serialized PHP format.

Specific parameter:
Other general parameters are available.
formatversion

Output formatting

1
Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
2
Modern format.
latest
Use the latest format (currently 2), may change without warning.
One of the following values: 1, 2, latest
Default: 1

format=phpfm

Output data in serialized PHP format (pretty-print in HTML).

Specific parameters:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)
formatversion

Output formatting

1
Backwards-compatible format (XML-style booleans, * keys for content nodes, etc.).
2
Modern format.
latest
Use the latest format (currently 2), may change without warning.
One of the following values: 1, 2, latest
Default: 1

format=rawfm

Output data, including debugging elements, in JSON format (pretty-print in HTML).

Specific parameter:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)

format=xml

(main | xml)

Output data in XML format.

Specific parameter:
Other general parameters are available.
includexmlnamespace

If specified, adds an XML namespace.

Type: boolean (details)

format=xmlfm

Output data in XML format (pretty-print in HTML).

Specific parameters:
Other general parameters are available.
wrappedhtml

Return the pretty-printed HTML and associated ResourceLoader modules as a JSON object.

Type: boolean (details)
includexmlnamespace

If specified, adds an XML namespace.

Type: boolean (details)

Credits

API developers:

  • Yuri Astrakhan (creator, lead developer Sep 2006–Sep 2007)
  • Roan Kattouw (lead developer Sep 2007–2009)
  • Victor Vasiliev
  • Bryan Tong Minh
  • Sam Reed
  • Brad Jorsch (lead developer 2013–2020)

Please send your comments, suggestions and questions to mediawiki-api@lists.wikimedia.org or file a bug report at https://phabricator.wikimedia.org/.